Recombinant Human PGLYRP1 protein, His&Myc-tagged
Cat.No. : | PGLYRP1-3334H |
Product Overview : | Recombinant Human PGLYRP1 protein(O75594)(22-196aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 22-196aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.9 kDa |
AA Sequence : | QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PGLYRP1 peptidoglycan recognition protein 1 [ Homo sapiens ] |
Official Symbol | PGLYRP1 |
Synonyms | PGLYRP1; peptidoglycan recognition protein 1; peptidoglycan recognition protein , PGLYRP, TNFSF3L; PGRP; PGRP S; PGRPS; TAG7; TNF superfamily, member 3 (LTB)-like (peptidoglycan recognition protein); PGLYRP; PGRP-S; TNFSF3L; MGC126894; MGC126896; |
Gene ID | 8993 |
mRNA Refseq | NM_005091 |
Protein Refseq | NP_005082 |
MIM | 604963 |
UniProt ID | O75594 |
◆ Recombinant Proteins | ||
PGLYRP1-787C | Recombinant Cynomolgus PGLYRP1 Protein, His-tagged | +Inquiry |
Pglyrp1-570M | Active Recombinant Mouse Pglyrp1, His-tagged | +Inquiry |
Pglyrp1-1072M | Recombinant Mouse Pglyrp1 protein, His-tagged | +Inquiry |
Pglyrp1-3335M | Recombinant Mouse Pglyrp1 protein, His&Myc-tagged | +Inquiry |
PGLYRP1-1207H | Recombinant Human PGLYRP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGLYRP1-1873MCL | Recombinant Mouse PGLYRP1 cell lysate | +Inquiry |
PGLYRP1-1339HCL | Recombinant Human PGLYRP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGLYRP1 Products
Required fields are marked with *
My Review for All PGLYRP1 Products
Required fields are marked with *
0
Inquiry Basket