Recombinant Human PGM2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PGM2-2865H |
Product Overview : | PGM2 MS Standard C13 and N15-labeled recombinant protein (NP_060760) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Catalyzes the conversion of the nucleoside breakdown products ribose-1-phosphate and deoxyribose-1-phosphate to the corresponding 5-phosphopentoses. May also catalyze the interconversion of glucose-1-phosphate and glucose-6-phosphate. Has low glucose 1,6-bisphosphate synthase activity. |
Molecular Mass : | 68.3 kDa |
AA Sequence : | MAAPEGSGLDEDARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGISRMNDLTIIQTTQGFCRYLEKQFSDLKQKGIVISFDARAHPSSGGSSRRFARLAATTFISQGIPVYLFSDITPTPFVPFTVSHLKLCAGIMITASHNPKQDNGYKVYWDNGAQIISPHDKGISQAIEENLEPWPQAWDDSLIDSSPLLHNPSASINNDYFEDLKKYCFHRSVNRETKVKFVHTSVHGVGHSFVQSAFKAFDLVPPEAVPEQKDPDPEFPTVKYPNPEEGKGVLTLSFALADKTKARIVLANDPDADRLAVAEKQDSGEWRVFSGNELGALLGWWLFTSWKEKNQDRSALKDTYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRAKQLIDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVISAELASFLATKNLSLSQQLKAIYVEYGYHITKASYFICHDQETIKKLFENLRNYDGKNNYPKACGKFEISAIRDLTTGYDDSQPDKKAVLPTSKSSQMITFTFANGGVATMRTSGTEPKIKYYAELCAPPGNSDPEQLKKELNELVSAIEEHFFQPQKYNLQPKADTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PGM2 phosphoglucomutase 2 [ Homo sapiens (human) ] |
Official Symbol | PGM2 |
Synonyms | PGM2; phosphoglucomutase 2; phosphoglucomutase-2; FLJ10983; phosphopentomutase; PGM 2; phosphodeoxyribomutase; glucose phosphomutase 2; MSTP006; |
Gene ID | 55276 |
mRNA Refseq | NM_018290 |
Protein Refseq | NP_060760 |
MIM | 172000 |
UniProt ID | Q96G03 |
◆ Recombinant Proteins | ||
PGM2-12144Z | Recombinant Zebrafish PGM2 | +Inquiry |
Pgm2-4824M | Recombinant Mouse Pgm2 Protein, Myc/DDK-tagged | +Inquiry |
PGM2-1668H | Recombinant Human PGM2, GST-tagged | +Inquiry |
PGM2-4970H | Recombinant Human PGM2 Protein (Met1-Asp612), N-His tagged | +Inquiry |
PGM2-115H | Recombinant Human PGM2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGM2-3251HCL | Recombinant Human PGM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGM2 Products
Required fields are marked with *
My Review for All PGM2 Products
Required fields are marked with *
0
Inquiry Basket