Recombinant Human PGR protein, His-tagged
| Cat.No. : | PGR-3881H |
| Product Overview : | Recombinant Human PGR protein(1-301 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 09, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-301 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGKPRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTVM |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PGR progesterone receptor [ Homo sapiens ] |
| Official Symbol | PGR |
| Synonyms | PGR; progesterone receptor; NR3C3; PR; nuclear receptor subfamily 3 group C member 3; |
| Gene ID | 5241 |
| mRNA Refseq | NM_000926 |
| Protein Refseq | NP_000917 |
| MIM | 607311 |
| UniProt ID | P06401 |
| ◆ Recombinant Proteins | ||
| PGR-183H | Recombinant Human PGR protein, MYC/DDK-tagged | +Inquiry |
| Pgr-4828M | Recombinant Mouse Pgr Protein, Myc/DDK-tagged | +Inquiry |
| PGR-5861H | Recombinant Human PGR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PGR-6753H | Recombinant Human PGR protein, His & T7-tagged | +Inquiry |
| PGR-3395R | Recombinant Rhesus monkey PGR Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PGR Products
Required fields are marked with *
My Review for All PGR Products
Required fields are marked with *
