Recombinant Human PGS1 protein, GST-tagged
Cat.No. : | PGS1-30110H |
Product Overview : | Recombinant Human PGS1 (200-549 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu200-Phe549 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | LIPERFNETIGLQHIKVYLFDNSVILSGANLSDSYFTNRQDRYVFLQDCAEIADFFTELVDAVGDVSLQLQGDDTVQVVDGMVHPYKGDRAEYCKAANKRVMDVINSARTRQQMLHAQTFHSNSLLTQEDAAAAGDRRPAPDTWIYPLIQMKPFEIQIDEIVTETLLTEAERGAKVYLTTGYFNLTQAYMDLVLGTRAEYQILLASPEVNGFFGAKGVAGAIPAAYVHIERQFFSEVCSLGQQERVQLQEYWRRGWTFHAKGLWLYLAGSSLPCLTLIGSPNFGYRSVHRDLEAQIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTPLIKNFF |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PGS1 phosphatidylglycerophosphate synthase 1 [ Homo sapiens ] |
Official Symbol | PGS1 |
Synonyms | PGS1; phosphatidylglycerophosphate synthase 1; CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial; DKFZP762M186; PGP synthase 1; MGC131960; DKFZp762M186; |
Gene ID | 9489 |
mRNA Refseq | NM_024419 |
Protein Refseq | NP_077733 |
MIM | 614942 |
UniProt ID | Q32NB8 |
◆ Recombinant Proteins | ||
PGS1-3397R | Recombinant Rhesus monkey PGS1 Protein, His-tagged | +Inquiry |
PGS1-1671H | Recombinant Human PGS1, His-tagged | +Inquiry |
PGS1-3215R | Recombinant Rhesus Macaque PGS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PGS1-1841C | Recombinant Chicken PGS1 | +Inquiry |
PGS1-30110H | Recombinant Human PGS1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGS1-3246HCL | Recombinant Human PGS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PGS1 Products
Required fields are marked with *
My Review for All PGS1 Products
Required fields are marked with *