Recombinant Human PHB protein, T7/His-tagged
Cat.No. : | PHB-181H |
Product Overview : | Recombinant human PHB cDNA (271 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQD IVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSI TTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERAR FVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | PHB prohibitin [ Homo sapiens ] |
Official Symbol | PHB |
Synonyms | PHB; prohibitin; PHB1; |
Gene ID | 5245 |
mRNA Refseq | NM_002634 |
Protein Refseq | NP_002625 |
MIM | 176705 |
UniProt ID | P35232 |
Chromosome Location | 17q21 |
Function | histone deacetylase binding; protein binding; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
PHB-4887H | Recombinant Human PHB Protein (Lys177-Gln272), N-His tagged | +Inquiry |
PHB-3400R | Recombinant Rhesus monkey PHB Protein, His-tagged | +Inquiry |
Phb-4832M | Recombinant Mouse Phb Protein, Myc/DDK-tagged | +Inquiry |
PHB-4077R | Recombinant Rat PHB Protein, His (Fc)-Avi-tagged | +Inquiry |
PHB-29709TH | Recombinant Human PHB | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHB-3241HCL | Recombinant Human PHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHB Products
Required fields are marked with *
My Review for All PHB Products
Required fields are marked with *