Recombinant Human PHB protein, T7/His-tagged
| Cat.No. : | PHB-181H |
| Product Overview : | Recombinant human PHB cDNA (271 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQD IVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSI TTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERAR FVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | PHB prohibitin [ Homo sapiens ] |
| Official Symbol | PHB |
| Synonyms | PHB; prohibitin; PHB1; |
| Gene ID | 5245 |
| mRNA Refseq | NM_002634 |
| Protein Refseq | NP_002625 |
| MIM | 176705 |
| UniProt ID | P35232 |
| Chromosome Location | 17q21 |
| Function | histone deacetylase binding; protein binding; transcription regulatory region DNA binding; |
| ◆ Recombinant Proteins | ||
| PHB-181H | Recombinant Human PHB protein, T7/His-tagged | +Inquiry |
| PHB-4088C | Recombinant Chicken PHB | +Inquiry |
| PHB-3218R | Recombinant Rhesus Macaque PHB Protein, His (Fc)-Avi-tagged | +Inquiry |
| Phb-4995M | Recombinant Mouse Phb protein, Avi-tagged, Biotinylated | +Inquiry |
| Phb-4994M | Recombinant Mouse Phb protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PHB-3241HCL | Recombinant Human PHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHB Products
Required fields are marked with *
My Review for All PHB Products
Required fields are marked with *



