Recombinant Human PHF1
| Cat.No. : | PHF1-30328TH |
| Product Overview : | Recombinant fragment of Human PHF1 with N terminal proprietary tag; Predicted MWt 36.52 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 99 amino acids |
| Description : | This gene encodes a Polycomb group protein. The protein is a component of a histone H3 lysine-27 (H3K27)-specific methyltransferase complex, and functions in transcriptional repression of homeotic genes. The protein is also recruited to double-strand breaks, and reduced protein levels results in X-ray sensitivity and increased homologous recombination. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 36.520kDa inclusive of tags |
| Tissue specificity : | Highest levels in heart, skeletal muscle, and pancreas, lower levels in brain, placenta, lung, liver and kidney. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | AQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVP |
| Sequence Similarities : | Contains 2 PHD-type zinc fingers. |
| Gene Name | PHF1 PHD finger protein 1 [ Homo sapiens ] |
| Official Symbol | PHF1 |
| Synonyms | PHF1; PHD finger protein 1; MTF2L2; |
| Gene ID | 5252 |
| mRNA Refseq | NM_002636 |
| Protein Refseq | NP_002627 |
| MIM | 602881 |
| Uniprot ID | O43189 |
| Chromosome Location | 6p21.3 |
| Function | metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| PHF1-1679H | Recombinant Human PHF1 protein, His-tagged | +Inquiry |
| PHF1-6682M | Recombinant Mouse PHF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PHF1-3403R | Recombinant Rhesus monkey PHF1 Protein, His-tagged | +Inquiry |
| PHF1-3221R | Recombinant Rhesus Macaque PHF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PHF1-12714M | Recombinant Mouse PHF1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PHF1-1344HCL | Recombinant Human PHF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHF1 Products
Required fields are marked with *
My Review for All PHF1 Products
Required fields are marked with *
