Recombinant Human PHLDA3 protein, GST-tagged

• Cat.No.: PHLDA3-1691H
• Product Overview: Recombinant Human PHLDA3 protein (31-127aa), fused with GST-tag at the N-terminus, was expressed in Wheat Germ and purified by Glutathione Sepharose 4 Fast Flow.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 31-127 a.a.
• Description: p53/TP53-regulated repressor of Akt/AKT1 signaling. Represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity. Its direct transcription regulation by p53/TP53 may explain how p53/TP53 can negatively regulate AKT1. May act as a tumor suppressor.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.41 kDa
• AA Sequence: CVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: PHLDA3
• Official Symbol: PHLDA3
• Synonyms: TIH1
• Gene ID: 23612
• mRNA Refseq: NM_012396.5
• Protein Refseq: NP_036528.1
• MIM: 607054
• UniProt ID: Q9Y5J5