Recombinant Human PHLDA3 protein, GST-tagged

Cat.No. : PHLDA3-1691H
Product Overview : Recombinant Human PHLDA3 protein (31-127aa), fused with GST-tag at the N-terminus, was expressed in Wheat Germ and purified by Glutathione Sepharose 4 Fast Flow.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 31-127 a.a.
Description : p53/TP53-regulated repressor of Akt/AKT1 signaling. Represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity. Its direct transcription regulation by p53/TP53 may explain how p53/TP53 can negatively regulate AKT1. May act as a tumor suppressor.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.41 kDa
AA Sequence : CVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name PHLDA3
Official Symbol PHLDA3
Synonyms TIH1
Gene ID 23612
mRNA Refseq NM_012396.5
Protein Refseq NP_036528.1
MIM 607054
UniProt ID Q9Y5J5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PHLDA3 Products

Required fields are marked with *

My Review for All PHLDA3 Products

Required fields are marked with *

0
cart-icon