Recombinant Human PI4KB protein, His-tagged
Cat.No. : | PI4KB-1703H |
Product Overview : | Recombinant Human PI4KB protein(449-801 aa), fused with His Tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 449-801 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | IGELQVELPEVHTNSCDNISQFSVDSITSQESKEPVFIAAGDIRRRLSEQLAHTPTAFKRDPEDPSAVALKEPWQEKVRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGYCLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRNLGFETSAFKLTTEFVDVMGGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PI4KB phosphatidylinositol 4-kinase, catalytic, beta [ Homo sapiens ] |
Official Symbol | PI4KB |
Synonyms | PI4KB; phosphatidylinositol 4-kinase, catalytic, beta; PIK4CB; phosphatidylinositol 4-kinase beta; PI4K BETA; pi4K92; PtdIns 4-kinase beta; type III phosphatidylinositol 4-kinase beta; phosphatidylinositol 4-kinase, wortmannin-sensitive; NPIK; PI4K92; PI4KBETA; PI4K-BETA; PI4KIIIBETA; FLJ30129; DKFZp686O1820; |
Gene ID | 5298 |
mRNA Refseq | NM_001198773 |
Protein Refseq | NP_001185702 |
MIM | 602758 |
UniProt ID | Q9UBF8 |
◆ Recombinant Proteins | ||
PI4KB-1702H | Recombinant Human PI4KB protein, His-tagged | +Inquiry |
PI4KB-1077H | Active Recombinant Human PI4KB, GST-tagged | +Inquiry |
Pi4kb-336M | Recombinant Mouse Pi4kb Protein, MYC/DDK-tagged | +Inquiry |
PI4KB-4440R | Recombinant Rat PI4KB Protein | +Inquiry |
PI4KB-162H | Active Recombinant Human PI4KB protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PI4KB-3206HCL | Recombinant Human PI4KB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PI4KB Products
Required fields are marked with *
My Review for All PI4KB Products
Required fields are marked with *
0
Inquiry Basket