Recombinant Human PI4KB protein, His-tagged

• Cat.No.: PI4KB-1703H
• Product Overview: Recombinant Human PI4KB protein(449-801 aa), fused with His Tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 449-801 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: IGELQVELPEVHTNSCDNISQFSVDSITSQESKEPVFIAAGDIRRRLSEQLAHTPTAFKRDPEDPSAVALKEPWQEKVRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGYCLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRNLGFETSAFKLTTEFVDVMGGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PI4KB phosphatidylinositol 4-kinase, catalytic, beta [ Homo sapiens ]
• Official Symbol: PI4KB
• Synonyms: PI4KB; phosphatidylinositol 4-kinase, catalytic, beta; PIK4CB; phosphatidylinositol 4-kinase beta; PI4K BETA; pi4K92; PtdIns 4-kinase beta; type III phosphatidylinositol 4-kinase beta; phosphatidylinositol 4-kinase, wortmannin-sensitive; NPIK; PI4K92; PI4KBETA; PI4K-BETA; PI4KIIIBETA; FLJ30129; DKFZp686O1820
• Gene ID: 5298
• mRNA Refseq: NM_001198773
• Protein Refseq: NP_001185702
• MIM: 602758
• UniProt ID: Q9UBF8