Recombinant Human PIAS3 protein, His-tagged
Cat.No. : | PIAS3-5643H |
Product Overview : | Recombinant Human PIAS3 protein(277-628 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 277-628 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | VRQLTAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDGLQYSPVQGGDPSENKKKVEVIDLTIESSSDEEDLPPTKKHCSVTSAAIPALPGSKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIVAPGGALREGHGGPLPSGPSLTGCRSDIISLD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PIAS3 protein inhibitor of activated STAT, 3 [ Homo sapiens ] |
Official Symbol | PIAS3 |
Synonyms | PIAS3; protein inhibitor of activated STAT, 3; E3 SUMO-protein ligase PIAS3; FLJ14651; zinc finger; MIZ type containing 5; ZMIZ5; zinc finger, MIZ-type containing 5; protein inhibitor of activated STAT protein 3; |
Gene ID | 10401 |
mRNA Refseq | NM_006099 |
Protein Refseq | NP_006090 |
MIM | 605987 |
UniProt ID | Q9Y6X2 |
◆ Recombinant Proteins | ||
PIAS3-4443R | Recombinant Rat PIAS3 Protein | +Inquiry |
PIAS3-1704H | Recombinant Human PIAS3, GST-tagged | +Inquiry |
PIAS3-6719M | Recombinant Mouse PIAS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PIAS3-4103R | Recombinant Rat PIAS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PIAS3-1245H | Recombinant Human PIAS3 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIAS3-3202HCL | Recombinant Human PIAS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIAS3 Products
Required fields are marked with *
My Review for All PIAS3 Products
Required fields are marked with *