Recombinant Human PICK1 Protein, GST-tagged
Cat.No. : | PICK1-661H |
Product Overview : | Recombinant Human PICK1 Full-Length ORF Protein (1-415 aa) is produced by Wheat Germ (in vitro) expression system. This protein is fused with a GST tag at the N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-415 aa |
Description : | The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha (PRKCA). This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It has been shown to interact with multiple glutamate receptor subtypes, monoamine plasma membrane transporters, as well as non-voltage gated sodium channels, and may target PRKCA to these membrane proteins and thus regulate their distribution and function. This protein has also been found to act as an anchoring protein that specifically targets PRKCA to mitochondria in a ligand-specific manner. Three transcript variants encoding the same protein have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 73 kDa |
AA Sequence : | MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | PICK1 protein interacting with PRKCA 1 [ Homo sapiens (human) ] |
Official Symbol | PICK1 |
Synonyms | MGC15204; PICK; PRKCABP; |
Gene ID | 9463 |
mRNA Refseq | NM_012407 |
Protein Refseq | NP_036539 |
UniProt ID | Q9NRD5 |
◆ Recombinant Proteins | ||
PICK1-3241R | Recombinant Rhesus Macaque PICK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PICK1-4692Z | Recombinant Zebrafish PICK1 | +Inquiry |
Pick1-4853M | Recombinant Mouse Pick1 Protein, Myc/DDK-tagged | +Inquiry |
PICK1-4327H | Recombinant Human PICK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PICK1-661H | Recombinant Human PICK1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PICK1-3198HCL | Recombinant Human PICK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PICK1 Products
Required fields are marked with *
My Review for All PICK1 Products
Required fields are marked with *
0
Inquiry Basket