Recombinant Human PIEZO2 protein(2427-2661aa), His-tagged

Cat.No. : PIEZO2-31H
Product Overview : Recombinant Human PIEZO2 protein(Q9H5I5)(2427-2661aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2427-2661aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 33.3 kDa
AA Sequence : KSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILSRDNTTKYNSEWWVLNLTGNRIYNPNSQALELVVFNDKVSPPS
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃.
Gene Name PIEZO2 piezo type mechanosensitive ion channel component 2 [ Homo sapiens (human) ]
Official Symbol PIEZO2
Synonyms DA3; DA5; MWKS; DAIPT; PIEZO2; HsT748; HsT771; FAM38B2; C18orf30; C18orf58
Gene ID 63895
mRNA Refseq NM_001378183
Protein Refseq NP_001365112
MIM 613629

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PIEZO2 Products

Required fields are marked with *

My Review for All PIEZO2 Products

Required fields are marked with *

0
cart-icon