Recombinant Human PIGG Protein, GST-tagged

Cat.No. : PIGG-5158H
Product Overview : Human GPI7 partial ORF ( NP_060203.2, 566 a.a. - 644 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an enzyme involved in glycosylphosphatidylinositol-anchor biosynthesis. The encoded protein, which is localized to the endoplasmic reticulum, is involved in transferring ethanoloamine phosphate to mannose 2 of glycosylphosphatidylinositol species H7 to form species H8. Allelic variants of this gene have been associated with intellectual disability, hypotonia, and early-onset seizures. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016]
Molecular Mass : 34.43 kDa
AA Sequence : EHQTWYFLVNTLCLALSQETYRNYFLGDDGEPPCGLCVEQGHDGATAAWQGGPGCDVLERDKGHGSPSTSEVLRGREKW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PIGG phosphatidylinositol glycan anchor biosynthesis, class G [ Homo sapiens ]
Official Symbol PIGG
Synonyms GPI7; LAS21; PRO4405; RLGS1930
Gene ID 54872
mRNA Refseq NM_017733
Protein Refseq NP_060203
MIM 616918
UniProt ID Q5H8A4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PIGG Products

Required fields are marked with *

My Review for All PIGG Products

Required fields are marked with *

0
cart-icon
0
compare icon