Recombinant Human PIGG Protein, GST-tagged
Cat.No. : | PIGG-5158H |
Product Overview : | Human GPI7 partial ORF ( NP_060203.2, 566 a.a. - 644 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an enzyme involved in glycosylphosphatidylinositol-anchor biosynthesis. The encoded protein, which is localized to the endoplasmic reticulum, is involved in transferring ethanoloamine phosphate to mannose 2 of glycosylphosphatidylinositol species H7 to form species H8. Allelic variants of this gene have been associated with intellectual disability, hypotonia, and early-onset seizures. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016] |
Molecular Mass : | 34.43 kDa |
AA Sequence : | EHQTWYFLVNTLCLALSQETYRNYFLGDDGEPPCGLCVEQGHDGATAAWQGGPGCDVLERDKGHGSPSTSEVLRGREKW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PIGG phosphatidylinositol glycan anchor biosynthesis, class G [ Homo sapiens ] |
Official Symbol | PIGG |
Synonyms | GPI7; LAS21; PRO4405; RLGS1930 |
Gene ID | 54872 |
mRNA Refseq | NM_017733 |
Protein Refseq | NP_060203 |
MIM | 616918 |
UniProt ID | Q5H8A4 |
◆ Recombinant Proteins | ||
PIGG-3608H | Recombinant Human PIGG protein, His-tagged | +Inquiry |
PIGG-5158H | Recombinant Human PIGG Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIGG Products
Required fields are marked with *
My Review for All PIGG Products
Required fields are marked with *