Recombinant Human PIGG Protein, GST-tagged

• Cat.No.: PIGG-5158H
• Product Overview: Human GPI7 partial ORF ( NP_060203.2, 566 a.a. - 644 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an enzyme involved in glycosylphosphatidylinositol-anchor biosynthesis. The encoded protein, which is localized to the endoplasmic reticulum, is involved in transferring ethanoloamine phosphate to mannose 2 of glycosylphosphatidylinositol species H7 to form species H8. Allelic variants of this gene have been associated with intellectual disability, hypotonia, and early-onset seizures. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016]
• Molecular Mass: 34.43 kDa
• AA Sequence: EHQTWYFLVNTLCLALSQETYRNYFLGDDGEPPCGLCVEQGHDGATAAWQGGPGCDVLERDKGHGSPSTSEVLRGREKW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PIGG phosphatidylinositol glycan anchor biosynthesis, class G [ Homo sapiens ]
• Official Symbol: PIGG
• Synonyms: GPI7; LAS21; PRO4405; RLGS1930
• Gene ID: 54872
• mRNA Refseq: NM_017733
• Protein Refseq: NP_060203
• MIM: 616918
• UniProt ID: Q5H8A4