Recombinant Human PIGU Protein, GST-Tagged

Cat.No. : PIGU-1325H
Product Overview : Human PIGU partial ORF (NP_536724, 101 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Cdc91, a predicted integral membrane protein that may function in cell division control. The protein encoded by this gene is the fifth subunit of GPI transamidase that attaches GPI-anchors to proteins. [provided by RefSeq, Jul 2008]
Molecular Mass : 32.89 kDa
AA Sequence : DFNKVVFKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYTILSCVAKSTCAINNT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PIGU phosphatidylinositol glycan anchor biosynthesis, class U [ Homo sapiens ]
Official Symbol PIGU
Synonyms PIGU; phosphatidylinositol glycan anchor biosynthesis, class U; GAB1; CDC91L1; phosphatidylinositol glycan anchor biosynthesis class U protein; protein CDC91-like 1; GPI transamidase subunit; GPI transamidase component PIG-U; cell division cycle 91-like 1 protein; cell division cycle protein 91-like 1; CDC91 (cell division cycle 91, S. cerevisiae, homolog)-like 1; bA346K17.2; CDC91 cell division cycle 91-like 1 (S. cerevisiae)
Gene ID 28869
mRNA Refseq NM_080476
Protein Refseq NP_536724
MIM 608528
UniProt ID Q9H490

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PIGU Products

Required fields are marked with *

My Review for All PIGU Products

Required fields are marked with *

0
cart-icon