Recombinant Human PIK3CB protein, His-tagged
Cat.No. : | PIK3CB-3991H |
Product Overview : | Recombinant Human PIK3CB protein(139-373 aa), fused to His tag, was expressed in E. coli. |
Availability | August 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 139-373 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SLKDPEVNEFRRKMRKFSEEKILSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGKEDEVSPYDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRALPHFILVECCKIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCKTIVSSEV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PIK3CB phosphoinositide-3-kinase, catalytic, beta polypeptide [ Homo sapiens ] |
Official Symbol | PIK3CB |
Synonyms | PIK3CB; phosphoinositide-3-kinase, catalytic, beta polypeptide; PIK3C1; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform; PI3K-beta; PtdIns-3-kinase p110; PI3-kinase subunit beta; PI3-kinase p110 subunit beta; ptdIns-3-kinase subunit beta; ptdIns-3-kinase subunit p110-beta; phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta; PI3K; P110BETA; PI3KBETA; MGC133043; DKFZp779K1237; |
Gene ID | 5291 |
mRNA Refseq | NM_001256045 |
Protein Refseq | NP_001242974 |
MIM | 602925 |
UniProt ID | P42338 |
◆ Recombinant Proteins | ||
PIK3CB-01H | Recombinant Human PIK3CB/PIK3R2 Protein, His-tagged | +Inquiry |
PIK3CB-2278HF | Active Recombinant Full Length Human PIK3CB Protein, GST-tagged | +Inquiry |
PIK3CB-2965C | Recombinant Chicken PIK3CB | +Inquiry |
PIK3CB-1810HF | Active Recombinant Full Length Human PIK3CB Protein, DDK-tagged, Biotinylated | +Inquiry |
PIK3CB-6738M | Recombinant Mouse PIK3CB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIK3CB-3188HCL | Recombinant Human PIK3CB 293 Cell Lysate | +Inquiry |
CPBTT-30929CH | Chicken Anti-Human PI3K Polyclonal Antibody | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIK3CB Products
Required fields are marked with *
My Review for All PIK3CB Products
Required fields are marked with *