Recombinant Human PIK3CD protein, His-tagged

Cat.No. : PIK3CD-8555H
Product Overview : Recombinant Human PIK3CD protein(395-580 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 395-580 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : YAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSAL
Purity : 85%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name PIK3CD phosphoinositide-3-kinase, catalytic, delta polypeptide [ Homo sapiens ]
Official Symbol PIK3CD
Synonyms PIK3CD; phosphoinositide-3-kinase, catalytic, delta polypeptide; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform; p110D; phosphatidylinositol 3 kinase; catalytic; delta polypeptide; phosphoinositide 3 kinase C; PI3Kdelta; phosphoinositide-3-kinase C; PI3-kinase p110 subunit delta; ptdIns-3-kinase subunit p110-delta; phosphoinositide-3-kinase, catalytic, delta polypeptide variant p37delta; phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta; PI3K; P110DELTA;
mRNA Refseq NM_005026
Protein Refseq NP_005017
MIM 602839
UniProt ID O00329
Gene ID 5293

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PIK3CD Products

Required fields are marked with *

My Review for All PIK3CD Products

Required fields are marked with *

0
cart-icon