Recombinant Human PIK3CD protein, His-tagged
Cat.No. : | PIK3CD-8555H |
Product Overview : | Recombinant Human PIK3CD protein(395-580 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 395-580 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | YAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSAL |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | PIK3CD phosphoinositide-3-kinase, catalytic, delta polypeptide [ Homo sapiens ] |
Official Symbol | PIK3CD |
Synonyms | PIK3CD; phosphoinositide-3-kinase, catalytic, delta polypeptide; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform; p110D; phosphatidylinositol 3 kinase; catalytic; delta polypeptide; phosphoinositide 3 kinase C; PI3Kdelta; phosphoinositide-3-kinase C; PI3-kinase p110 subunit delta; ptdIns-3-kinase subunit p110-delta; phosphoinositide-3-kinase, catalytic, delta polypeptide variant p37delta; phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta; PI3K; P110DELTA; |
mRNA Refseq | NM_005026 |
Protein Refseq | NP_005017 |
MIM | 602839 |
UniProt ID | O00329 |
Gene ID | 5293 |
◆ Recombinant Proteins | ||
PIK3CD-1727H | Recombinant Human PIK3CD protein, His & T7-tagged | +Inquiry |
PIK3CD-11416Z | Recombinant Zebrafish PIK3CD | +Inquiry |
PIK3CD-1896H | Recombinant Human Phosphoinositide-3-Kinase, Catalytic, Delta Polypeptide, His-tagged | +Inquiry |
PIK3CD-4900H | Recombinant Human PIK3CD Protein (Val774-Gln1044), N-His tagged | +Inquiry |
PIK3CD-301404H | Recombinant Human PIK3CD protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIK3CD-3187HCL | Recombinant Human PIK3CD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PIK3CD Products
Required fields are marked with *
My Review for All PIK3CD Products
Required fields are marked with *
0
Inquiry Basket