Recombinant Human PIK3R1 protein, His-tagged
Cat.No. : | PIK3R1-2925H |
Product Overview : | Recombinant Human PIK3R1 protein(319-372 aa), fused to His tag, was expressed in E. coli. |
Availability | July 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 319-372 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PIK3R1 phosphoinositide-3-kinase, regulatory subunit 1 (alpha) [ Homo sapiens ] |
Official Symbol | PIK3R1 |
Synonyms | PIK3R1; phosphoinositide-3-kinase, regulatory subunit 1 (alpha); phosphatidylinositol 3-kinase regulatory subunit alpha; GRB1; p85; p85 ALPHA; PI3-kinase subunit p85-alpha; PI3K regulatory subunit alpha; ptdIns-3-kinase regulatory subunit alpha; phosphatidylinositol 3-kinase-associated p-85 alpha; phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha; phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha); p85-ALPHA; |
Gene ID | 5295 |
mRNA Refseq | NM_001242466 |
Protein Refseq | NP_001229395 |
MIM | 171833 |
UniProt ID | P27986 |
◆ Recombinant Proteins | ||
PIK3R1-31096TH | Recombinant Human Human PIK3CB, His-tagged | +Inquiry |
PIK3R1-4463R | Recombinant Rat PIK3R1 Protein | +Inquiry |
PIK3R1-4123R | Recombinant Rat PIK3R1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PIK3R1-4904H | Recombinant Human PIK3R1 Protein (Trp624-Val718), N-His tagged | +Inquiry |
PIK3R1-4864H | Recombinant Human Phosphoinositide-3-Kinase, Regulatory Subunit 1 (Alpha), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIK3R1-3185HCL | Recombinant Human PIK3R1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIK3R1 Products
Required fields are marked with *
My Review for All PIK3R1 Products
Required fields are marked with *