Recombinant Human PIK3R3 protein, GST-tagged

• Cat.No.: PIK3R3-3673H
• Product Overview: Recombinant Human PIK3R3 protein(312-382 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 312-382 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: HLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLI
• Purity: 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PIK3R3 phosphoinositide-3-kinase, regulatory subunit 3 (gamma) [ Homo sapiens ]
• Official Symbol: PIK3R3
• Synonyms: PIK3R3; phosphoinositide-3-kinase, regulatory subunit 3 (gamma); phosphatidylinositol 3-kinase regulatory subunit gamma; p55; p55PIK; PI3-kinase subunit p55-gamma; PI3K regulatory subunit gamma; 100% homology to SWISS-PROT Q92569; PI3-kinase regulatory subunit gamma; ptdIns-3-kinase regulatory subunit gamma; ptdIns-3-kinase regulatory subunit p55-gamma; phosphoinositide-3-kinase, regulatory subunit 3 (p55, gamma); phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma; phosphoinositide-3-kinase, regulatory subunit, polypeptide 3 (p55, gamma); phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 3 (p55, gamma); p55-GAMMA; FLJ41892; DKFZp686P05226
• Gene ID: 8503
• mRNA Refseq: NM_001114172
• Protein Refseq: NP_001107644
• MIM: 606076
• UniProt ID: Q92569