Recombinant Human PIK3R3 protein, GST-tagged

Cat.No. : PIK3R3-3673H
Product Overview : Recombinant Human PIK3R3 protein(312-382 aa), fused to GST tag, was expressed in E. coli.
Availability January 16, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 312-382 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : HLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLI
Purity : 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PIK3R3 phosphoinositide-3-kinase, regulatory subunit 3 (gamma) [ Homo sapiens ]
Official Symbol PIK3R3
Synonyms PIK3R3; phosphoinositide-3-kinase, regulatory subunit 3 (gamma); phosphatidylinositol 3-kinase regulatory subunit gamma; p55; p55PIK; PI3-kinase subunit p55-gamma; PI3K regulatory subunit gamma; 100% homology to SWISS-PROT Q92569; PI3-kinase regulatory subunit gamma; ptdIns-3-kinase regulatory subunit gamma; ptdIns-3-kinase regulatory subunit p55-gamma; phosphoinositide-3-kinase, regulatory subunit 3 (p55, gamma); phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma; phosphoinositide-3-kinase, regulatory subunit, polypeptide 3 (p55, gamma); phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 3 (p55, gamma); p55-GAMMA; FLJ41892; DKFZp686P05226;
Gene ID 8503
mRNA Refseq NM_001114172
Protein Refseq NP_001107644
MIM 606076
UniProt ID Q92569

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PIK3R3 Products

Required fields are marked with *

My Review for All PIK3R3 Products

Required fields are marked with *

0
cart-icon
0
compare icon