Recombinant Human PIM1 protein, GST-tagged

• Cat.No.: PIM1-301405H
• Product Overview: Recombinant Human PIM1 (244-313 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: His244-Lys313
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: HDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: PIM1 pim-1 oncogene [ Homo sapiens ]
• Official Symbol: PIM1
• Synonyms: PIM1; pim-1 oncogene; PIM; serine/threonine-protein kinase pim-1; Oncogene PIM1; pim-1 kinase 44 kDa isoform; pim-1 oncogene (proviral integration site 1); proto-oncogene serine/threonine-protein kinase pim-1
• Gene ID: 5292
• mRNA Refseq: NM_001243186
• Protein Refseq: NP_001230115
• MIM: 164960
• UniProt ID: P11309