Recombinant Human PIM1 protein, His-tagged
Cat.No. : | PIM1-2714H |
Product Overview : | Recombinant Human PIM1 protein(244-313 aa), fused to His tag, was expressed in E. coli. |
Availability | July 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 244-313 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | HDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PIM1 pim-1 oncogene [ Homo sapiens ] |
Official Symbol | PIM1 |
Synonyms | PIM1; pim-1 oncogene; PIM; serine/threonine-protein kinase pim-1; Oncogene PIM1; pim-1 kinase 44 kDa isoform; pim-1 oncogene (proviral integration site 1); proto-oncogene serine/threonine-protein kinase pim-1; |
Gene ID | 5292 |
mRNA Refseq | NM_001243186 |
Protein Refseq | NP_001230115 |
MIM | 164960 |
UniProt ID | P11309 |
◆ Recombinant Proteins | ||
PIM1-1288H | Recombinant Human Pim-1 Oncogene, His-tagged | +Inquiry |
PIM1-2714H | Recombinant Human PIM1 protein, His-tagged | +Inquiry |
PIM1-959HFL | Recombinant Full Length Human PIM1 Protein, C-Flag-tagged | +Inquiry |
PIM1-4898H | Recombinant Human PIM1 Protein (Ser98-Lys410), His tagged | +Inquiry |
PIM1-301405H | Recombinant Human PIM1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIM1-3181HCL | Recombinant Human PIM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIM1 Products
Required fields are marked with *
My Review for All PIM1 Products
Required fields are marked with *