Recombinant Human PINK1 protein, His-tagged

• Cat.No.: PINK1-3194H
• Product Overview: Recombinant Human PINK1 protein(150-300 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 150-300 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: GFRLEEYLIGQSIGKGCSAAVYEATMPTLPQNLEVTKSTGLLPGRGPGTSAPGEGQERAAGAPAFPLAIKMMWNISAGSSSEAILNTMSQELVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLP
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: PINK1 PTEN induced putative kinase 1 [ Homo sapiens ]
• Official Symbol: PINK1
• Synonyms: PINK1; PTEN induced putative kinase 1; PARK6, Parkinson disease (autosomal recessive) 6; serine/threonine-protein kinase PINK1, mitochondrial; protein kinase BRPK; PTEN-induced putative kinase protein 1; BRPK; PARK6; FLJ27236
• Gene ID: 65018
• mRNA Refseq: NM_032409
• Protein Refseq: NP_115785
• MIM: 608309
• UniProt ID: Q9BXM7