Recombinant Human PINK1 protein, His-tagged
Cat.No. : | PINK1-3194H |
Product Overview : | Recombinant Human PINK1 protein(150-300 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | June 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 150-300 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | GFRLEEYLIGQSIGKGCSAAVYEATMPTLPQNLEVTKSTGLLPGRGPGTSAPGEGQERAAGAPAFPLAIKMMWNISAGSSSEAILNTMSQELVPASRVALAGEYGAVTYRKSKRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PINK1 PTEN induced putative kinase 1 [ Homo sapiens ] |
Official Symbol | PINK1 |
Synonyms | PINK1; PTEN induced putative kinase 1; PARK6, Parkinson disease (autosomal recessive) 6; serine/threonine-protein kinase PINK1, mitochondrial; protein kinase BRPK; PTEN-induced putative kinase protein 1; BRPK; PARK6; FLJ27236; |
Gene ID | 65018 |
mRNA Refseq | NM_032409 |
Protein Refseq | NP_115785 |
MIM | 608309 |
UniProt ID | Q9BXM7 |
◆ Recombinant Proteins | ||
PINK1-12820M | Recombinant Mouse PINK1 Protein | +Inquiry |
PINK1-535C | Recombinant Cynomolgus Monkey PINK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PINK1-792C | Recombinant Cynomolgus PINK1 Protein, His-tagged | +Inquiry |
PINK1-1917Z | Recombinant Zebrafish PINK1 | +Inquiry |
PINK1-357H | Recombinant Human PTEN Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PINK1-3929HCL | Recombinant Human PINK1 Cell Lysate | +Inquiry |
PINK1-1352HCL | Recombinant Human PINK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PINK1 Products
Required fields are marked with *
My Review for All PINK1 Products
Required fields are marked with *
0
Inquiry Basket