Recombinant Human PIP Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PIP-2920H
• Product Overview: PIP MS Standard C13 and N15-labeled recombinant protein (NP_002643) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Belongs to the PIP family.
• Molecular Mass: 16.6 kDa
• AA Sequence: MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PIP prolactin-induced protein [ Homo sapiens (human) ]
• Official Symbol: PIP
• Synonyms: PIP; prolactin-induced protein; prolactin-inducible protein; GCDFP 15; GCDFP15; GPIP4; prolactin inducible protein; SABP; secretory actin-binding protein; gross cystic disease fluid protein 15; GCDFP-15
• Gene ID: 5304
• mRNA Refseq: NM_002652
• Protein Refseq: NP_002643
• MIM: 176720
• UniProt ID: P12273