Recombinant Human PIP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PIP-2920H |
Product Overview : | PIP MS Standard C13 and N15-labeled recombinant protein (NP_002643) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Belongs to the PIP family. |
Molecular Mass : | 16.6 kDa |
AA Sequence : | MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PIP prolactin-induced protein [ Homo sapiens (human) ] |
Official Symbol | PIP |
Synonyms | PIP; prolactin-induced protein; prolactin-inducible protein; GCDFP 15; GCDFP15; GPIP4; prolactin inducible protein; SABP; secretory actin-binding protein; gross cystic disease fluid protein 15; GCDFP-15; |
Gene ID | 5304 |
mRNA Refseq | NM_002652 |
Protein Refseq | NP_002643 |
MIM | 176720 |
UniProt ID | P12273 |
◆ Recombinant Proteins | ||
Pip-5747R | Recombinant Rat Pip protein, His-tagged | +Inquiry |
Pip-1925M | Recombinant Mouse Pip protein, His & GST-tagged | +Inquiry |
PIP-213H | Recombinant Human PIP Protein, DDK-tagged | +Inquiry |
PIP-4128R | Recombinant Rat PIP Protein, His (Fc)-Avi-tagged | +Inquiry |
Pip-1926R | Recombinant Rat Pip protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
PIP-20H | Native Human PIP Protein (118 aa) | +Inquiry |
PIP-17HFL | Native Full Length Human Prolactin inducible protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIP-3176HCL | Recombinant Human PIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PIP Products
Required fields are marked with *
My Review for All PIP Products
Required fields are marked with *
0
Inquiry Basket