Recombinant Human PIP Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PIP-2920H |
| Product Overview : | PIP MS Standard C13 and N15-labeled recombinant protein (NP_002643) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Belongs to the PIP family. |
| Molecular Mass : | 16.6 kDa |
| AA Sequence : | MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PIP prolactin-induced protein [ Homo sapiens (human) ] |
| Official Symbol | PIP |
| Synonyms | PIP; prolactin-induced protein; prolactin-inducible protein; GCDFP 15; GCDFP15; GPIP4; prolactin inducible protein; SABP; secretory actin-binding protein; gross cystic disease fluid protein 15; GCDFP-15; |
| Gene ID | 5304 |
| mRNA Refseq | NM_002652 |
| Protein Refseq | NP_002643 |
| MIM | 176720 |
| UniProt ID | P12273 |
| ◆ Recombinant Proteins | ||
| PIP-5495H | Recombinant Human PIP protein, His-tagged | +Inquiry |
| PIP-2308H | Recombinant Human PIP, His-tagged | +Inquiry |
| PIP-4911H | Recombinant Human PIP Protein (Met1-Glu146), His tagged | +Inquiry |
| PIP-1683H | Recombinant Human PIP Protein, His (Fc)-Avi-tagged | +Inquiry |
| PIP-4468R | Recombinant Rat PIP Protein | +Inquiry |
| ◆ Native Proteins | ||
| PIP-20H | Native Human PIP Protein (118 aa) | +Inquiry |
| PIP-17HFL | Native Full Length Human Prolactin inducible protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PIP-3176HCL | Recombinant Human PIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIP Products
Required fields are marked with *
My Review for All PIP Products
Required fields are marked with *



