Recombinant Human PIP Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PIP-2920H
Product Overview : PIP MS Standard C13 and N15-labeled recombinant protein (NP_002643) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Belongs to the PIP family.
Molecular Mass : 16.6 kDa
AA Sequence : MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PIP prolactin-induced protein [ Homo sapiens (human) ]
Official Symbol PIP
Synonyms PIP; prolactin-induced protein; prolactin-inducible protein; GCDFP 15; GCDFP15; GPIP4; prolactin inducible protein; SABP; secretory actin-binding protein; gross cystic disease fluid protein 15; GCDFP-15;
Gene ID 5304
mRNA Refseq NM_002652
Protein Refseq NP_002643
MIM 176720
UniProt ID P12273

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PIP Products

Required fields are marked with *

My Review for All PIP Products

Required fields are marked with *

0
cart-icon