Recombinant Human PIR protein, GST-tagged
Cat.No. : | PIR-1730H |
Product Overview : | Recombinant Human PIR protein(46-230 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 46-230 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | KGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVEN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PIR pirin (iron-binding nuclear protein) [ Homo sapiens ] |
Official Symbol | PIR |
Synonyms | PIR; pirin (iron-binding nuclear protein); pirin; probable quercetinase; probable quercetin 2,3-dioxygenase PIR; |
Gene ID | 8544 |
mRNA Refseq | NM_003662 |
Protein Refseq | NP_003653 |
MIM | 603329 |
UniProt ID | O00625 |
◆ Recombinant Proteins | ||
PIR-671Z | Recombinant Zebrafish PIR | +Inquiry |
Pir-4877M | Recombinant Mouse Pir Protein, Myc/DDK-tagged | +Inquiry |
PIR-7608H | Recombinant Human PIR protein | +Inquiry |
PIR-1730H | Recombinant Human PIR protein, GST-tagged | +Inquiry |
PIR-12833M | Recombinant Mouse PIR Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIR-3168HCL | Recombinant Human PIR 293 Cell Lysate | +Inquiry |
PIR-3169HCL | Recombinant Human PIR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIR Products
Required fields are marked with *
My Review for All PIR Products
Required fields are marked with *