Recombinant Human PITPNM1 protein, GST-tagged
| Cat.No. : | PITPNM1-301330H |
| Product Overview : | Recombinant Human PITPNM1 (1158-1243 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Leu1158-Glu1243 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | LSDGYVAHLGQLEAGSHSHASSGPPRAALGKSSYGVAAPVDFLRKQSQLLRSRGPSQAEREGPGTPPTTLARGKARSISLKLDSEE |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | PITPNM1 phosphatidylinositol transfer protein, membrane-associated 1 [ Homo sapiens ] |
| Official Symbol | PITPNM1 |
| Synonyms | Rd9; NIR2; RDGB; DRES9; RDGB1; RDGBA; PITPNM; RDGBA1 |
| Gene ID | 9600 |
| mRNA Refseq | NM_004910.2 |
| Protein Refseq | NP_004901.2 |
| MIM | 608794 |
| UniProt ID | O00562 |
| ◆ Recombinant Proteins | ||
| PITPNM1-4135R | Recombinant Rat PITPNM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PITPNM1-12846M | Recombinant Mouse PITPNM1 Protein | +Inquiry |
| PITPNM1-4475R | Recombinant Rat PITPNM1 Protein | +Inquiry |
| PITPNM1-6040H | Recombinant Human PITPNM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PITPNM1-6766M | Recombinant Mouse PITPNM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PITPNM1-1356HCL | Recombinant Human PITPNM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PITPNM1 Products
Required fields are marked with *
My Review for All PITPNM1 Products
Required fields are marked with *
