Recombinant Human PITX3 protein(21-90 aa), C-His-tagged
Cat.No. : | PITX3-2486H |
Product Overview : | Recombinant Human PITX3 protein(O75364)(21-90 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-90 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | AGTPHPQLPEHGCKGQEHSDSEKASASLPGGSPEDGSLKKKQRRQRTHFTSQQLQELEATFQRNRYPDMS |
Gene Name | PITX3 paired-like homeodomain 3 [ Homo sapiens ] |
Official Symbol | PITX3 |
Synonyms | PITX3; paired-like homeodomain 3; paired like homeodomain transcription factor 3; pituitary homeobox 3; homeobox protein PITX3; PTX3; CTPP4; MGC12766; |
Gene ID | 5309 |
mRNA Refseq | NM_005029 |
Protein Refseq | NP_005020 |
UniProt ID | O75364 |
◆ Recombinant Proteins | ||
PITX3-6771M | Recombinant Mouse PITX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PITX3-720M | Recombinant Mouse PITX3 Protein (1-302 aa), GST-tagged | +Inquiry |
PITX3-645H | Recombinant Human PITX3 Protein, GST-His-tagged | +Inquiry |
PITX3-4138R | Recombinant Rat PITX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PITX3-2486H | Recombinant Human PITX3 protein(21-90 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PITX3-3162HCL | Recombinant Human PITX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PITX3 Products
Required fields are marked with *
My Review for All PITX3 Products
Required fields are marked with *
0
Inquiry Basket