Recombinant Human PIWIL1 Protein, GST-tagged

Cat.No. : PIWIL1-33H
Product Overview : Human PIWIL1 partial ORF ( NP_004755.2, 431 a.a. - 541 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.95 kDa
AA Sequence : NDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEAY
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name PIWIL1 piwi-like 1 (Drosophila) [ Homo sapiens ]
Official Symbol PIWIL1
Synonyms PIWIL1; piwi-like 1 (Drosophila); piwi (Drosophila) like 1; piwi-like protein 1; HIWI; PIWI; piwi homolog; MIWI
Gene ID 9271
mRNA Refseq NM_001190971
Protein Refseq NP_001177900
MIM 605571
UniProt ID Q96J94

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PIWIL1 Products

Required fields are marked with *

My Review for All PIWIL1 Products

Required fields are marked with *

0
cart-icon