Recombinant Human PIWIL1 Protein, GST-tagged
| Cat.No. : | PIWIL1-33H |
| Product Overview : | Human PIWIL1 partial ORF ( NP_004755.2, 431 a.a. - 541 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 37.95 kDa |
| AA Sequence : | NDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEAY |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | PIWIL1 piwi-like 1 (Drosophila) [ Homo sapiens ] |
| Official Symbol | PIWIL1 |
| Synonyms | PIWIL1; piwi-like 1 (Drosophila); piwi (Drosophila) like 1; piwi-like protein 1; HIWI; PIWI; piwi homolog; MIWI |
| Gene ID | 9271 |
| mRNA Refseq | NM_001190971 |
| Protein Refseq | NP_001177900 |
| MIM | 605571 |
| UniProt ID | Q96J94 |
| ◆ Recombinant Proteins | ||
| PIWIL1-3714C | Recombinant Chicken PIWIL1 | +Inquiry |
| PIWIL1-3443R | Recombinant Rhesus monkey PIWIL1 Protein, His-tagged | +Inquiry |
| PIWIL1-9698Z | Recombinant Zebrafish PIWIL1 | +Inquiry |
| PIWIL1-1736H | Recombinant Human PIWIL1, His-tagged | +Inquiry |
| PIWIL1-3261R | Recombinant Rhesus Macaque PIWIL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PIWIL1-1359HCL | Recombinant Human PIWIL1 cell lysate | +Inquiry |
| PIWIL1-391HKCL | Human PIWIL1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIWIL1 Products
Required fields are marked with *
My Review for All PIWIL1 Products
Required fields are marked with *
