Recombinant Human PIWIL2 protein, His-tagged

Cat.No. : PIWIL2-1737H
Product Overview : Recombinant Human PIWIL2 protein(662-973 aa), fused with His tag, was expressed in E.coli.
Availability December 01, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 662-973 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : AEGKIQMVVCIIMGPRDDLYGAIKKLCCVQSPVPSQVVNVRTIGQPTRLRSVAQKILLQINCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQEIVDSLKLCLVGSLKKFYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAFENYQPKMVVFVVQKKISTNLYLAAPQNFVTPTPGTVVDHTITSCEWVDFYLLAHHVRQGCGIPTHYVCVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGHILHHEPAIQLCENLFFL
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PIWIL2 piwi-like 2 (Drosophila) [ Homo sapiens ]
Official Symbol PIWIL2
Synonyms PIWIL2; piwi-like 2 (Drosophila); piwi-like protein 2; cancer/testis antigen 80; CT80; FLJ10351; HILI; Hiwi like; Mili; Miwi like; piwil2-like protein; mili; PIWIL1L; MGC133049;
Gene ID 55124
mRNA Refseq NM_001135721
Protein Refseq NP_001129193
MIM 610312
UniProt ID Q8TC59

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PIWIL2 Products

Required fields are marked with *

My Review for All PIWIL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon