Recombinant Human PIWIL2 protein, His-tagged
Cat.No. : | PIWIL2-1737H |
Product Overview : | Recombinant Human PIWIL2 protein(662-973 aa), fused with His tag, was expressed in E.coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 662-973 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | AEGKIQMVVCIIMGPRDDLYGAIKKLCCVQSPVPSQVVNVRTIGQPTRLRSVAQKILLQINCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQEIVDSLKLCLVGSLKKFYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAFENYQPKMVVFVVQKKISTNLYLAAPQNFVTPTPGTVVDHTITSCEWVDFYLLAHHVRQGCGIPTHYVCVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGHILHHEPAIQLCENLFFL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PIWIL2 piwi-like 2 (Drosophila) [ Homo sapiens ] |
Official Symbol | PIWIL2 |
Synonyms | PIWIL2; piwi-like 2 (Drosophila); piwi-like protein 2; cancer/testis antigen 80; CT80; FLJ10351; HILI; Hiwi like; Mili; Miwi like; piwil2-like protein; mili; PIWIL1L; MGC133049; |
Gene ID | 55124 |
mRNA Refseq | NM_001135721 |
Protein Refseq | NP_001129193 |
MIM | 610312 |
UniProt ID | Q8TC59 |
◆ Recombinant Proteins | ||
PIWIL2-12853M | Recombinant Mouse PIWIL2 Protein | +Inquiry |
PIWIL2-5055Z | Recombinant Zebrafish PIWIL2 | +Inquiry |
PIWIL2-6773M | Recombinant Mouse PIWIL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PIWIL2-3444R | Recombinant Rhesus monkey PIWIL2 Protein, His-tagged | +Inquiry |
PIWIL2-3262R | Recombinant Rhesus Macaque PIWIL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIWIL2-1360HCL | Recombinant Human PIWIL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PIWIL2 Products
Required fields are marked with *
My Review for All PIWIL2 Products
Required fields are marked with *
0
Inquiry Basket