Recombinant Human PKDCC Protein, GST-tagged
Cat.No. : | PKDCC-4745H |
Product Overview : | Human LOC91461 full-length ORF ( NP_612379.1, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | PKDCC (Protein Kinase Domain Containing, Cytoplasmic) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and non-membrane spanning protein tyrosine kinase activity. |
Molecular Mass : | 59.7 kDa |
AA Sequence : | MVLLERLRHPNVLQLYGYCYQDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLDDARVEETPCAGSTDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLEKVLHLYRSGQYLQNSTASSSTEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTTYVKASG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PKDCC protein kinase domain containing, cytoplasmic [ Homo sapiens (human) ] |
Official Symbol | PKDCC |
Synonyms | PKDCC; protein kinase domain containing, cytoplasmic; Vlk; SGK493; extracellular tyrosine-protein kinase PKDCC; protein kinase domain containing, cytoplasmic homolog; protein kinase domain-containing protein, cytoplasmic; protein kinase-like protein SgK493; sugen kinase 493; vertebrate lonesome kinase; EC 2.7.10.2 |
Gene ID | 91461 |
mRNA Refseq | NM_138370 |
Protein Refseq | NP_612379 |
MIM | 614150 |
UniProt ID | Q504Y2 |
◆ Recombinant Proteins | ||
Pkdcc-5110M | Recombinant Mouse Pkdcc protein, His&Myc-tagged | +Inquiry |
PKDCC-5940HF | Recombinant Full Length Human PKDCC Protein, GST-tagged | +Inquiry |
Pkdcc-5788M | Recombinant Mouse Pkdcc protein, His-tagged | +Inquiry |
PKDCC-12863M | Recombinant Mouse PKDCC Protein | +Inquiry |
PKDCC-01H | Recombinant Human PKDCC Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PKDCC-1025HCL | Recombinant Human PKDCC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PKDCC Products
Required fields are marked with *
My Review for All PKDCC Products
Required fields are marked with *