Recombinant Human PKDCC Protein, His-tagged

Cat.No. : PKDCC-41H
Product Overview : Recombinant Human PKDCC Protein(200-493 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 200-493 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence : QNSTASSSTEYQCIPDSTIPQEDYRCWPSYHHGSCLLSVFNLAEAVDVCESHAQCRAFVVTNQTTWTGRQLVFFKTGWSQVVPDPNKTTYVKASG
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Gene Name PKDCC protein kinase domain containing, cytoplasmic homolog (mouse) [ Homo sapiens ]
Official Symbol PKDCC
Synonyms PKDCC; protein kinase domain containing, cytoplasmic homolog (mouse); protein kinase domain-containing protein, cytoplasmic; SgK493; vertebrate lonesome kinase; Vlk; sugen kinase 493; protein kinase-like protein SgK493; SGK493; FLJ18197; MGC125960;
Gene ID 91461
mRNA Refseq NM_138370
Protein Refseq NP_612379
MIM 614150
UniProt ID Q504Y2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PKDCC Products

Required fields are marked with *

My Review for All PKDCC Products

Required fields are marked with *

0
cart-icon
0
compare icon