Recombinant Human PLA2G12A Protein (23-185 aa), His-tagged
| Cat.No. : | PLA2G12A-1709H |
| Product Overview : | Recombinant Human PLA2G12A Protein (23-185 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 23-185 aa |
| Description : | PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 20.3 kDa |
| AA Sequence : | QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEE |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | PLA2G12A phospholipase A2, group XIIA [ Homo sapiens ] |
| Official Symbol | PLA2G12A |
| Synonyms | PLA2G12A; sPLA2-XII; GXII sPLA2; GXII; ROSSY; PLA2G12; |
| Gene ID | 81579 |
| mRNA Refseq | NM_030821 |
| Protein Refseq | NP_110448 |
| MIM | 611652 |
| UniProt ID | Q9BZM1 |
| ◆ Recombinant Proteins | ||
| PLA2G12A-6794M | Recombinant Mouse PLA2G12A Protein, His (Fc)-Avi-tagged | +Inquiry |
| PLA2G12A-1709H | Recombinant Human PLA2G12A Protein (23-185 aa), His-tagged | +Inquiry |
| Pla2g12a-8261M | Recombinant Mouse Pla2g12a protein, His & T7-tagged | +Inquiry |
| Pla2g12a-4794M | Recombinant Mouse Pla2g12a protein, His&Myc-tagged | +Inquiry |
| PLA2G12A-1749H | Recombinant Human PLA2G12A, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLA2G12A-482HCL | Recombinant Human PLA2G12A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLA2G12A Products
Required fields are marked with *
My Review for All PLA2G12A Products
Required fields are marked with *



