Recombinant Human PLA2G12A Protein (23-185 aa), His-tagged
Cat.No. : | PLA2G12A-1709H |
Product Overview : | Recombinant Human PLA2G12A Protein (23-185 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 23-185 aa |
Description : | PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Does not exhibit detectable activity toward sn-2-arachidonoyl- or linoleoyl-phosphatidylcholine or -phosphatidylethanolamine. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 20.3 kDa |
AA Sequence : | QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | PLA2G12A phospholipase A2, group XIIA [ Homo sapiens ] |
Official Symbol | PLA2G12A |
Synonyms | PLA2G12A; sPLA2-XII; GXII sPLA2; GXII; ROSSY; PLA2G12; |
Gene ID | 81579 |
mRNA Refseq | NM_030821 |
Protein Refseq | NP_110448 |
MIM | 611652 |
UniProt ID | Q9BZM1 |
◆ Recombinant Proteins | ||
PLA2G12A-207HFL | Recombinant Full Length Human PLA2G12A Protein, C-Flag-tagged | +Inquiry |
Pla2g12a-4794M | Recombinant Mouse Pla2g12a protein, His&Myc-tagged | +Inquiry |
Pla2g12a-8261M | Recombinant Mouse Pla2g12a protein, His & T7-tagged | +Inquiry |
PLA2G12A-72H | Recombinant Human Phospholipase A2, Group XIIA, His-tagged | +Inquiry |
Pla2g12a-712M | Recombinant Mouse Phospholipase A2, Group XIIA | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G12A-482HCL | Recombinant Human PLA2G12A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLA2G12A Products
Required fields are marked with *
My Review for All PLA2G12A Products
Required fields are marked with *