Recombinant Human PLA2G1B Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | PLA2G1B-291H |
Product Overview : | PLA2G1B MS Standard C13 and N15-labeled recombinant protein (NP_000919) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. The encoded calcium-dependent enzyme catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids. AA is subsequently converted by downstream metabolic enzymes to several bioactive lipophilic compounds (eicosanoids), including prostaglandins (PGs) and leukotrienes (LTs). The enzyme may be involved in several physiological processes including cell contraction, cell proliferation and pathological response. [provided by RefSeq, Aug 2013] |
Molecular Mass : | 16.2 kDa |
AA Sequence : | MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PLA2G1B phospholipase A2, group IB (pancreas) [ Homo sapiens (human) ] |
Official Symbol | PLA2G1B |
Synonyms | PLA2G1B; phospholipase A2, group IB (pancreas); PLA2, PLA2A, PPLA2; phospholipase A2; group IB phospholipase A2; phosphatidylcholine 2-acylhydrolase 1B; PLA2; PLA2A; PPLA2; MGC119834; MGC119835; |
Gene ID | 5319 |
mRNA Refseq | NM_000928 |
Protein Refseq | NP_000919 |
MIM | 172410 |
UniProt ID | P04054 |
◆ Recombinant Proteins | ||
PLA2G1B-1878H | Recombinant Human PLA2G1B Protein, MYC/DDK-tagged | +Inquiry |
Pla2g1b-1185M | Recombinant Mouse Pla2g1b protein(Met1-Cys146), His-tagged | +Inquiry |
PLA2G1B-291H | Recombinant Human PLA2G1B Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
PLA2G1B-4147R | Recombinant Rat PLA2G1B Protein, His (Fc)-Avi-tagged | +Inquiry |
PLA2G1B-66H | Recombinant Human Phospholipase A2, Group IB (Pancreas), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G1B-2200HCL | Recombinant Human PLA2G1B cell lysate | +Inquiry |
PLA2G1B-2033MCL | Recombinant Mouse PLA2G1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLA2G1B Products
Required fields are marked with *
My Review for All PLA2G1B Products
Required fields are marked with *
0
Inquiry Basket