Recombinant Human PLA2G1B Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : PLA2G1B-291H
Product Overview : PLA2G1B MS Standard C13 and N15-labeled recombinant protein (NP_000919) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. The encoded calcium-dependent enzyme catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids. AA is subsequently converted by downstream metabolic enzymes to several bioactive lipophilic compounds (eicosanoids), including prostaglandins (PGs) and leukotrienes (LTs). The enzyme may be involved in several physiological processes including cell contraction, cell proliferation and pathological response. [provided by RefSeq, Aug 2013]
Molecular Mass : 16.2 kDa
AA Sequence : MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PLA2G1B phospholipase A2, group IB (pancreas) [ Homo sapiens (human) ]
Official Symbol PLA2G1B
Synonyms PLA2G1B; phospholipase A2, group IB (pancreas); PLA2, PLA2A, PPLA2; phospholipase A2; group IB phospholipase A2; phosphatidylcholine 2-acylhydrolase 1B; PLA2; PLA2A; PPLA2; MGC119834; MGC119835;
Gene ID 5319
mRNA Refseq NM_000928
Protein Refseq NP_000919
MIM 172410
UniProt ID P04054

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLA2G1B Products

Required fields are marked with *

My Review for All PLA2G1B Products

Required fields are marked with *

0
cart-icon