Recombinant Human PLA2G2D Protein

Cat.No. : PLA2G2D-8493H
Product Overview : Recombinant Human PLA2G2D was produced in E. coli.
Availability August 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene encodes a secreted member of the phospholipase A2 family, and is found in a cluster of related family members on chromosome 1. Phospholipase A2 family members hydrolyze the sn-2 fatty acid ester bond of glycerophospholipids to produce lysophospholipids and free fatty acid. This gene may be involved in inflammation and immune response, and in weight loss associated with chronic obstructive pulmonary disease. Alternative splicing results in multiple transcript variants encoding different isoforms.
Form : 20 mM Tris-HCl, 100mM NaCl, PH8.0
Molecular Mass : ~16.5 kDa
AA sequence : MRGSHHHHHHGMASHMGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCC QTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLD TYQKRLRFYWRPHCRGQTPGC
Endotoxin : < 1.0 EU per μg of the protein as determined by the LAL method
Purity : >95% by SDS-PAGE
Gene Name PLA2G2D phospholipase A2, group IID [ Homo sapiens ]
Official Symbol PLA2G2D
Synonyms PLA2G2D; phospholipase A2, group IID; group IID secretory phospholipase A2; sPLA2S; PLA2IID; sPLA2-IID; GIID sPLA2; secretory phospholipase A2s; phosphatidylcholine 2-acylhydrolase 2D; secretory-type PLA, stroma-associated homolog; SPLASH;
Gene ID 26279
mRNA Refseq NM_012400
Protein Refseq NP_036532
MIM 605630
UniProt ID Q9UNK4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLA2G2D Products

Required fields are marked with *

My Review for All PLA2G2D Products

Required fields are marked with *

0
cart-icon