Recombinant Human PLA2G2D Protein
Cat.No. : | PLA2G2D-8493H |
Product Overview : | Recombinant Human PLA2G2D was produced in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a secreted member of the phospholipase A2 family, and is found in a cluster of related family members on chromosome 1. Phospholipase A2 family members hydrolyze the sn-2 fatty acid ester bond of glycerophospholipids to produce lysophospholipids and free fatty acid. This gene may be involved in inflammation and immune response, and in weight loss associated with chronic obstructive pulmonary disease. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | 20 mM Tris-HCl, 100mM NaCl, PH8.0 |
Molecular Mass : | ~16.5 kDa |
AA sequence : | MRGSHHHHHHGMASHMGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCC QTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLD TYQKRLRFYWRPHCRGQTPGC |
Endotoxin : | < 1.0 EU per μg of the protein as determined by the LAL method |
Purity : | >95% by SDS-PAGE |
Gene Name | PLA2G2D phospholipase A2, group IID [ Homo sapiens ] |
Official Symbol | PLA2G2D |
Synonyms | PLA2G2D; phospholipase A2, group IID; group IID secretory phospholipase A2; sPLA2S; PLA2IID; sPLA2-IID; GIID sPLA2; secretory phospholipase A2s; phosphatidylcholine 2-acylhydrolase 2D; secretory-type PLA, stroma-associated homolog; SPLASH; |
Gene ID | 26279 |
mRNA Refseq | NM_012400 |
Protein Refseq | NP_036532 |
MIM | 605630 |
UniProt ID | Q9UNK4 |
◆ Recombinant Proteins | ||
PLA2G2D-29526TH | Recombinant Human PLA2G2D, His-tagged | +Inquiry |
Pla2g2d-1477R | Recombinant Rat Pla2g2d protein, His & T7-tagged | +Inquiry |
PLA2G2D-8493H | Recombinant Human PLA2G2D Protein | +Inquiry |
PLA2G2D-365H | Recombinant Human PLA2G2D, Fc-tagged | +Inquiry |
PLA2G2D-4944H | Recombinant Human PLA2G2D protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G2D-757HCL | Recombinant Human PLA2G2D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLA2G2D Products
Required fields are marked with *
My Review for All PLA2G2D Products
Required fields are marked with *
0
Inquiry Basket