Recombinant Human PLA2G4A, His-tagged
Cat.No. : | PLA2G4A-557H |
Product Overview : | Recombinant Human PLA2G4A is manufactured with N-terminal fusion HisTag. sPLA2-X His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2. It is expressed inEscherichia Coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators. The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of low molecular weight, Ca2+requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense. |
Amino Acid Sequence : | MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ RDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQE LLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD. |
Physical Appearance : | Sterile Filtered lyophilized (freeze-dried) powder. |
Purity : | Greater than 95% as determined by SDS PAGE. |
Formulation : | Sterile filtered and lyophilized from 0.5 mg/ml in 0.01M Tris buffer pH 7.2. |
Stability : | Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C. The lyophilized protein remains stable until the expiry date when stored at -20°C. |
Gene Name | PLA2G4A phospholipase A2, group IVA (cytosolic, calcium-dependent) [ Homo sapiens ] |
Synonyms | PLA2G4A; phospholipase A2, group IVA (cytosolic, calcium-dependent); PLA2G4; MGC126350; cPLA2-alpha; PLA2G4A; cytosolic phospholipase A2; cPLA2; lysophospholipase; phospholipase A2 group IVA; phosphatidylcholine 2-acylhydrolase; calcium-dependent phospholipid-binding protein; EC 3.1.1.4; EC 3.1.1.5 |
Gene ID | 5321 |
mRNA Refseq | NM_024420 |
Protein Refseq | NP_077734 |
MIM | 600522 |
UniProt ID | P47712 |
Chromosome Location | 1q25 |
Pathway | Arachidonic acid metabolism; Ether lipid metabolism; Fc epsilon RI signaling pathway; Fc gamma R-mediated phagocytosisGlycerophospholipid metabolism; GnRH signaling pathway; Long-term depression; MAPK signaling pathway; Vascular smooth muscle contraction; alpha-Linolenic acid metabolism; Opioid Signalling |
Function | calcium-dependent phospholipase A2 activity; hydrolase activity; lysophospholipase activity; phospholipase A2 activity |
◆ Recombinant Proteins | ||
PLA2G4A-4321HFL | Recombinant Full Length Human PLA2G4A protein, Flag-tagged | +Inquiry |
PLA2G4A-12895M | Recombinant Mouse PLA2G4A Protein, His-tagged | +Inquiry |
PLA2G4A-1752H | Recombinant Human PLA2G4A, GST-tagged | +Inquiry |
PLA2G4A-6974C | Recombinant Chicken PLA2G4A | +Inquiry |
PLA2G4A-12894M | Recombinant Mouse PLA2G4A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G4A-3141HCL | Recombinant Human PLA2G4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLA2G4A Products
Required fields are marked with *
My Review for All PLA2G4A Products
Required fields are marked with *