Recombinant Human PLA2G7, GST-tagged
Cat.No. : | PLA2G7-105H |
Product Overview : | Human PLA2G7 full-length ORF ( AAH38452.1, 22 a.a. - 441 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a secreted enzyme that catalyzes the degradation of platelet-activating factor to biologically inactive products. Defects in this gene are a cause of platelet-activating factor acetylhydrolase deficiency. Two transcript variants encoding the same protein have been found for this gene. |
Molecular Mass : | 71.72 kDa |
AA Sequence : | FDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTL WIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHG FIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDIDHGKPVK NALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSEY FQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFATGKIIGHMLKLKGDIDSNAAIDLSNKASLAFLQKHL GLHKDFDQWDCLIEGDDENLIPGTNINTTNQHIMLQNSSGIEKYN |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PLA2G7 phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma) [ Homo sapiens (human) ] |
Official Symbol | PLA2G7 |
Synonyms | PLA2G7; PAFAD; PAFAH; LP-PLA2; LDL-PLA2; phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma); platelet-activating factor acetylhydrolase; LDL-PLA(2); gVIIA-PLA2; PAF 2-acylhydrolase; PAF acetylhydrolase; group-VIIA phospholipase A2; LDL-associated phospholipase A2; lipoprotein-associated phospholipase A2; 1-alkyl-2-acetylglycerophosphocholine esterase; 2-acetyl-1-alkylglycerophosphocholine esterase; EC 3.1.1.47 |
Gene ID | 7941 |
mRNA Refseq | NM_001168357 |
Protein Refseq | NP_001161829 |
MIM | 601690 |
UniProt ID | Q13093 |
Chromosome Location | 6p21.2-p12 |
Pathway | Ether lipid metabolism; Lissencephaly gene (LIS1) in neuronal migration and development; Metabolism of proteins |
Function | 1-alkyl-2-acetylglycerophosphocholine esterase activity; calcium-independent phospholipase A2 activity; phospholipid binding |
◆ Recombinant Proteins | ||
PLA2G7-687H | Recombinant Human phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma), His-tagged | +Inquiry |
Pla2g7-5920M | Recombinant Mouse Pla2g7 protein, His&Myc-tagged | +Inquiry |
PLA2G7-089H | Recombinant Human PLA2G7 Protein, His-tagged | +Inquiry |
PLA2G7-37H | Recombinant Human PLA2G7 Protein, His-tagged | +Inquiry |
PLA2G7-6528C | Recombinant Chicken PLA2G7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G7-2057HCL | Recombinant Human PLA2G7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLA2G7 Products
Required fields are marked with *
My Review for All PLA2G7 Products
Required fields are marked with *
0
Inquiry Basket