Recombinant Human PLAA protein, GST-tagged
| Cat.No. : | PLAA-13H |
| Product Overview : | Recombinant Human PLAA(639 a.a. - 738 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 639-738 a.a. |
| Description : | PLAA played an important role in many functions. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | KNIHIALATLALNYSVCFHKDHNIEGKAQCLSLISTILEVVQDLEATFRLLVALGTLISDDSNAVQLAKSLGVDSQIKKYSSVSEPAKVSECCRFILNLL |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | PLAA phospholipase A2-activating protein [ Homo sapiens ] |
| Official Symbol | PLAA |
| Synonyms | PLAA; phospholipase A2-activating protein; phospholipase A-2-activating protein; DOA1; DOA1 homolog (S. cerevisiae); FLJ11281; FLJ12699; PLA2P; PLAP; DOA1 homolog; phospholipase A2 activating protein; |
| Gene ID | 9373 |
| mRNA Refseq | NM_001031689 |
| Protein Refseq | NP_001026859 |
| MIM | 603873 |
| UniProt ID | Q9Y263 |
| Chromosome Location | 9p21 |
| Pathway | Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; |
| Function | phospholipase A2 activator activity; |
| ◆ Recombinant Proteins | ||
| PLAA-13H | Recombinant Human PLAA protein, GST-tagged | +Inquiry |
| PLAA-3456R | Recombinant Rhesus monkey PLAA Protein, His-tagged | +Inquiry |
| PLAA-6806M | Recombinant Mouse PLAA Protein, His (Fc)-Avi-tagged | +Inquiry |
| PLAA-12H | Recombinant Human PLAA protein, GST-tagged | +Inquiry |
| PLAA-2600H | Recombinant Human PLAA protein, His & MBP-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLAA-272HKCL | Human PLAA Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLAA Products
Required fields are marked with *
My Review for All PLAA Products
Required fields are marked with *
