Recombinant Human PLAA protein, GST-tagged

• Cat.No.: PLAA-13H
• Product Overview: Recombinant Human PLAA(639 a.a. - 738 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 639-738 a.a.
• Description: PLAA played an important role in many functions.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: KNIHIALATLALNYSVCFHKDHNIEGKAQCLSLISTILEVVQDLEATFRLLVALGTLISDDSNAVQLAKSLGVDSQIKKYSSVSEPAKVSECCRFILNLL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: PLAA phospholipase A2-activating protein [ Homo sapiens ]
• Official Symbol: PLAA
• Synonyms: PLAA; phospholipase A2-activating protein; phospholipase A-2-activating protein; DOA1; DOA1 homolog (S. cerevisiae); FLJ11281; FLJ12699; PLA2P; PLAP; DOA1 homolog; phospholipase A2 activating protein
• Gene ID: 9373
• mRNA Refseq: NM_001031689
• Protein Refseq: NP_001026859
• MIM: 603873
• UniProt ID: Q9Y263
• Chromosome Location: 9p21
• Pathway: Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem
• Function: phospholipase A2 activator activity