Recombinant Human PLAC1 Protein
| Cat.No. : | PLAC1-07H |
| Product Overview : | Recombinant Human PLAC1 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Protein Length : | 23-212aa |
| Description : | Involved in placenta development. Predicted to be located in extracellular region. |
| Form : | Liquid. In 50mM Tris-HCl, 150mM NaCl, pH 8.0. |
| Molecular Mass : | ~21.3 kDa |
| AA Sequence : | QSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGSM |
| Purity : | >90% |
| Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 0.42 mg/ml |
| Official Full Name : | Placenta enriched 1 |
| Gene Name | PLAC1 placenta enriched 1 [ Homo sapiens (human) ] |
| Official Symbol | PLAC1 |
| Synonyms | CT92; OOSP2B; OOSP2L |
| Gene ID | 10761 |
| mRNA Refseq | NM_001316887 |
| Protein Refseq | NP_001303816 |
| MIM | 300296 |
| UniProt ID | Q9HBJ0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLAC1 Products
Required fields are marked with *
My Review for All PLAC1 Products
Required fields are marked with *
