Recombinant Human PLAC1 Protein
Cat.No. : | PLAC1-07H |
Product Overview : | Recombinant Human PLAC1 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 23-212aa |
Description : | Involved in placenta development. Predicted to be located in extracellular region. |
Form : | Liquid. In 50mM Tris-HCl, 150mM NaCl, pH 8.0. |
Molecular Mass : | ~21.3 kDa |
AA Sequence : | QSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGSM |
Purity : | >90% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.42 mg/ml |
Official Full Name : | Placenta enriched 1 |
Gene Name | PLAC1 placenta enriched 1 [ Homo sapiens (human) ] |
Official Symbol | PLAC1 |
Synonyms | CT92; OOSP2B; OOSP2L |
Gene ID | 10761 |
mRNA Refseq | NM_001316887 |
Protein Refseq | NP_001303816 |
MIM | 300296 |
UniProt ID | Q9HBJ0 |
◆ Recombinant Proteins | ||
Plac1-4906M | Recombinant Mouse Plac1 Protein, Myc/DDK-tagged | +Inquiry |
PLAC1-07H | Recombinant Human PLAC1 Protein | +Inquiry |
PLAC1-3457R | Recombinant Rhesus monkey PLAC1 Protein, His-tagged | +Inquiry |
PLAC1-4472H | Recombinant Human PLAC1 protein, His-tagged | +Inquiry |
PLAC1-3928H | Recombinant Human PLAC1 Protein (Gln23-Met212), N-GST and C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAC1-3138HCL | Recombinant Human PLAC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLAC1 Products
Required fields are marked with *
My Review for All PLAC1 Products
Required fields are marked with *