Recombinant Human PLAC1 protein, His-tagged
Cat.No. : | PLAC1-4472H |
Product Overview : | Recombinant Human PLAC1 protein(Q9HBJ0)(23-212aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-212aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 23.3 kDa |
AA Sequence : | QSPMTVLCSIDWFMVTVHPFMLNNDVCVHFHELHLGLGCPPNHVQPHAYQFTYRVTECGIRAKAVSQDMVIYSTEIHYSSKGTPSKFVIPVSCAAPQKSPWLTKPCSMRVASKSRATAQKDEKCYEVFSLSQSSQRPNCDCPPCVFSEEEHTQVPCHQAGAQEAQPLQPSHFLDISEDWSLHTDDMIGSM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | PLAC1 placenta-specific 1 [ Homo sapiens ] |
Official Symbol | PLAC1 |
Synonyms | PLAC1; placenta-specific 1; placenta-specific protein 1; cancer/testis antigen 92; CT92; |
Gene ID | 10761 |
mRNA Refseq | NM_021796 |
Protein Refseq | NP_068568 |
MIM | 300296 |
UniProt ID | Q9HBJ0 |
◆ Recombinant Proteins | ||
PLAC1-07H | Recombinant Human PLAC1 Protein | +Inquiry |
PLAC1-3928H | Recombinant Human PLAC1 Protein (Gln23-Met212), N-GST and C-His tagged | +Inquiry |
PLAC1-4492R | Recombinant Rat PLAC1 Protein | +Inquiry |
PLAC1-4472H | Recombinant Human PLAC1 protein, His-tagged | +Inquiry |
Plac1-4906M | Recombinant Mouse Plac1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAC1-3138HCL | Recombinant Human PLAC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLAC1 Products
Required fields are marked with *
My Review for All PLAC1 Products
Required fields are marked with *