Recombinant Human PLAT therapeutic protein(Reteplase)
Cat.No. : | PLAT-P033H |
Product Overview : | Recombinant Human tissue plasminogen activator is genetically engineered to retain and delete certain portions of human tPA. The protein is a deletion mutein of human tPA formed by deleting various amino acids present in endogenous human tPA. It contains 355 of the 527 amino acids of native human tPA (amino acids 1-3 and 176-527), and retains the activity-related kringle-2 and serine protease domains of human tPA. Three domains are deleted from retavase – kringle-1, finger, and epidermal growth factor (EGF). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | Non |
Protein Length : | 355 Aa |
Description : | This gene encodes tissue-type plasminogen activator, a secreted serine protease which converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. Tissue-type plasminogen activator is synthesized as a single chain which is cleaved by plasmin to a two chain disulfide linked protein. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding; decreased activity leads to hypofibrinolysis which can result in thrombosis or embolism. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. The expression product is the active ingredient of Retavase and Activase. |
Molecular Mass : | 39.6 kDa |
AA Sequence : | SYQGNSDCYFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWC HVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISS CWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNML CAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Alias : | PLAT; TPA; T-PA; Human t-PA (residues 1-3 and 176-527); Reteplasa; Reteplase, recombinant |
Gene Name | PLAT plasminogen activator, tissue [ Homo sapiens ] |
Official Symbol | PLAT |
Synonyms | PLAT; plasminogen activator, tissue; tissue-type plasminogen activator; alteplase; reteplase; t-plasminogen activator; plasminogen activator, tissue type; tissue plasminogen activator (t-PA); TPA; T-PA; DKFZp686I03148; |
Gene ID | 5327 |
mRNA Refseq | NM_000930 |
Protein Refseq | NP_000921 |
MIM | 173370 |
UniProt ID | P00750 |
Chromosome Location | 8p11.21 |
Pathway | Blood Clotting Cascade, organism-specific biosystem; Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; Dissolution of Fibrin Clot, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; Hemostasis, organism-specific biosystem; |
Function | peptidase activity; protein binding; serine-type endopeptidase activity; serine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
PLAT-1870H | Recombinant Human PLAT Protein, MYC/DDK-tagged | +Inquiry |
PLAT-052H | Recombinant Human PLAT Protein, GST and His-tagged | +Inquiry |
Plat-2741R | Recombinant Rat Plat protein, His-tagged | +Inquiry |
PLAT-72H | Active Recombinant Human PLAT protein(Ile311-Pro562), hFc-tagged | +Inquiry |
Plat-2739M | Recombinant Mouse Plat protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PLAT-30920TH | Native Human PLAT | +Inquiry |
PLAT-30946TH | Native Human PLAT | +Inquiry |
PLAT-01HFL | Recombinant Full Length Human PLAT Protein, His tagged | +Inquiry |
PLAT-29690TH | Native Human Human SERPINE1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAT-1498MCL | Recombinant Mouse PLAT cell lysate | +Inquiry |
PLAT-2833HCL | Recombinant Human PLAT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLAT Products
Required fields are marked with *
My Review for All PLAT Products
Required fields are marked with *