Recombinant Human PLAU protein, His-tagged
Cat.No. : | PLAU-4475H |
Product Overview : | Recombinant Human PLAU protein(P00749)(21-431aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-431aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.4 kDa |
AA Sequence : | SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | PLAU plasminogen activator, urokinase [ Homo sapiens ] |
Official Symbol | PLAU |
Synonyms | PLAU; plasminogen activator, urokinase; urokinase-type plasminogen activator; UPA; URK; U-plasminogen activator; plasminogen activator, urinary; ATF; QPD; u-PA; BDPLT5; |
Gene ID | 5328 |
mRNA Refseq | NM_001145031 |
Protein Refseq | NP_001138503 |
MIM | 191840 |
UniProt ID | P00749 |
◆ Recombinant Proteins | ||
PLAU -91R | Recombinant Active Rabbit Urokinase | +Inquiry |
PLAU-389H | Recombinant Human PLAU | +Inquiry |
Plau-1365M | Recombinant Mouse Plau protein, His-Avi-tagged | +Inquiry |
Plau-1297R | Recombinant Rat Plasminogen Activator, Urokinase | +Inquiry |
PLAU-12913M | Recombinant Mouse PLAU Protein | +Inquiry |
◆ Native Proteins | ||
PLAU-31689TH | Active Native Human Urokinase protein | +Inquiry |
PLAU-31777TH | Native Human Human SERPINE1 | +Inquiry |
PLAU -14H | Native Human HMW urokinase, fluorescein labeled | +Inquiry |
PLAU-31687TH | Native Human PLAU | +Inquiry |
PLAU-22H | Native Human PLAU protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAU-1734HCL | Recombinant Human PLAU cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLAU Products
Required fields are marked with *
My Review for All PLAU Products
Required fields are marked with *