Recombinant Human PLB1 protein, His-tagged
| Cat.No. : | PLB1-3553H |
| Product Overview : | Recombinant Human PLB1 protein(22-372 aa), fused to His tag, was expressed in E. coli. |
| Availability | June 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 22-372 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | QIHTSPRKSTLEGQLWPETLKNSPFPCNPNKLGVNMPSKSVHSLKPSDIKFVAAIGNLEIPPDPGTGDLEKQDWTERPQQVCMGVMTVLSDIIRYFSPSVPMPVCHTGKRVIPHDGAEDLWIQAQELVRNMKENLQLDFQFDWKLINVFFSNASQCYLCPSAQQNGLAAGGVDELMGVLDYLQQEVPRAFVNLVDLSEVAEVSRQYHGTWLSPAPEPCNCSEETTRLAKVVMQWSYQEAWNSLLASSRYSEQESFTVVFQPFFYETTPSLHSEDPRLQDSTTLAWHLWNRMMEPAGEKDEPLSVKHGRPMKCPSQESPYLFSYRNSNYLTRLQKPQDKLEVREGAEIRCPD |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PLB1 phospholipase B1 [ Homo sapiens ] |
| Official Symbol | PLB1 |
| Synonyms | PLB1; phospholipase B1; phospholipase B1, membrane-associated; FLJ30866; PLB; phospholipase B; phospholipase A2; lysophospholipase; phospholipase B/lipase; hPLB; PLB/LIP; |
| Gene ID | 151056 |
| mRNA Refseq | NM_001170585 |
| Protein Refseq | NP_001164056 |
| MIM | 610179 |
| UniProt ID | Q6P1J6 |
| ◆ Recombinant Proteins | ||
| PLB1-1872H | Recombinant Human PLB1 Protein, MYC/DDK-tagged | +Inquiry |
| PLB1-4156R | Recombinant Rat PLB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PLB1-3553H | Recombinant Human PLB1 protein, His-tagged | +Inquiry |
| PLB1-12915M | Recombinant Mouse PLB1 Protein | +Inquiry |
| PLB1-6812M | Recombinant Mouse PLB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLB1-1369HCL | Recombinant Human PLB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLB1 Products
Required fields are marked with *
My Review for All PLB1 Products
Required fields are marked with *
