Recombinant Human PLB1 protein, His-tagged
Cat.No. : | PLB1-3553H |
Product Overview : | Recombinant Human PLB1 protein(22-372 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-372 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QIHTSPRKSTLEGQLWPETLKNSPFPCNPNKLGVNMPSKSVHSLKPSDIKFVAAIGNLEIPPDPGTGDLEKQDWTERPQQVCMGVMTVLSDIIRYFSPSVPMPVCHTGKRVIPHDGAEDLWIQAQELVRNMKENLQLDFQFDWKLINVFFSNASQCYLCPSAQQNGLAAGGVDELMGVLDYLQQEVPRAFVNLVDLSEVAEVSRQYHGTWLSPAPEPCNCSEETTRLAKVVMQWSYQEAWNSLLASSRYSEQESFTVVFQPFFYETTPSLHSEDPRLQDSTTLAWHLWNRMMEPAGEKDEPLSVKHGRPMKCPSQESPYLFSYRNSNYLTRLQKPQDKLEVREGAEIRCPD |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PLB1 phospholipase B1 [ Homo sapiens ] |
Official Symbol | PLB1 |
Synonyms | PLB1; phospholipase B1; phospholipase B1, membrane-associated; FLJ30866; PLB; phospholipase B; phospholipase A2; lysophospholipase; phospholipase B/lipase; hPLB; PLB/LIP; |
Gene ID | 151056 |
mRNA Refseq | NM_001170585 |
Protein Refseq | NP_001164056 |
MIM | 610179 |
UniProt ID | Q6P1J6 |
◆ Recombinant Proteins | ||
PLB1-171H | Recombinant Human PLB1 Protein, His-tagged | +Inquiry |
PLB1-1311HFL | Recombinant Full Length Human PLB1 Protein, C-Flag-tagged | +Inquiry |
PLB1-4156R | Recombinant Rat PLB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Plb1-4910M | Recombinant Mouse Plb1 Protein, Myc/DDK-tagged | +Inquiry |
PLB1-1699H | Recombinant Human PLB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLB1-1369HCL | Recombinant Human PLB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLB1 Products
Required fields are marked with *
My Review for All PLB1 Products
Required fields are marked with *
0
Inquiry Basket