Recombinant Human PLCB3, His-tagged
Cat.No. : | PLCB3-27922TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1021-1234 of Human Phospholipase C beta 3 with an N terminal His tag. Predicted MWt: 26 kDa; |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the phosphoinositide phospholipase C beta enzyme family that catalyze the production of the secondary messengers diacylglycerol and inositol 1,4,5-triphosphate from phosphatidylinositol in G-protein-linked receptor-mediated signal transduction. Alternative splicing results in multiple transcript variants. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 165 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TKEGEDEAKRYQEFQNRQVQSLLELREAQVDAEAQRRLEH LRQALQRLREVVLDANTTQFKRLKEMNEREKKELQKIL DRKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSI RRLEEAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQEC QEQRARLPQEIRRSLLGEMPEGLGDGPLVACASNGHAP GSSGHLSGADSESQEENTQL |
Gene Name : | PLCB3 phospholipase C, beta 3 (phosphatidylinositol-specific) [ Homo sapiens ] |
Official Symbol : | PLCB3 |
Synonyms : | PLCB3; phospholipase C, beta 3 (phosphatidylinositol-specific); 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-3; |
Gene ID : | 5331 |
mRNA Refseq : | NM_000932 |
Protein Refseq : | NP_000923 |
MIM : | 600230 |
Uniprot ID : | Q01970 |
Chromosome Location : | 11q13 |
Pathway : | Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; |
Function : | calcium ion binding; calmodulin binding; hydrolase activity; phosphatidylinositol phospholipase C activity; phospholipase C activity; |
Products Types
◆ Recombinant Protein | ||
PLCB3-6593Z | Recombinant Zebrafish PLCB3 | +Inquiry |
PLCB3-1763H | Recombinant Human PLCB3, GST-tagged | +Inquiry |
PLCB3-4928H | Recombinant Human PLCB3 Protein (Asp318-Lys468), N-His tagged | +Inquiry |
Plcb3-7162M | Recombinant Mouse Plcb3 protein, His & T7-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket