Recombinant Human PLCB3, His-tagged
Cat.No. : | PLCB3-27922TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1021-1234 of Human Phospholipase C beta 3 with an N terminal His tag. Predicted MWt: 26 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1021-1234 a.a. |
Description : | This gene encodes a member of the phosphoinositide phospholipase C beta enzyme family that catalyze the production of the secondary messengers diacylglycerol and inositol 1,4,5-triphosphate from phosphatidylinositol in G-protein-linked receptor-mediated signal transduction. Alternative splicing results in multiple transcript variants. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 165 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TKEGEDEAKRYQEFQNRQVQSLLELREAQVDAEAQRRLEH LRQALQRLREVVLDANTTQFKRLKEMNEREKKELQKIL DRKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSI RRLEEAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQEC QEQRARLPQEIRRSLLGEMPEGLGDGPLVACASNGHAP GSSGHLSGADSESQEENTQL |
Gene Name | PLCB3 phospholipase C, beta 3 (phosphatidylinositol-specific) [ Homo sapiens ] |
Official Symbol | PLCB3 |
Synonyms | PLCB3; phospholipase C, beta 3 (phosphatidylinositol-specific); 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-3; |
Gene ID | 5331 |
mRNA Refseq | NM_000932 |
Protein Refseq | NP_000923 |
MIM | 600230 |
Uniprot ID | Q01970 |
Chromosome Location | 11q13 |
Pathway | Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; |
Function | calcium ion binding; calmodulin binding; hydrolase activity; phosphatidylinositol phospholipase C activity; phospholipase C activity; |
◆ Recombinant Proteins | ||
PLCB3-6593Z | Recombinant Zebrafish PLCB3 | +Inquiry |
PLCB3-27922TH | Recombinant Human PLCB3, His-tagged | +Inquiry |
Plcb3-7162M | Recombinant Mouse Plcb3 protein, His & T7-tagged | +Inquiry |
PLCB3-1763H | Recombinant Human PLCB3, GST-tagged | +Inquiry |
PLCB3-4928H | Recombinant Human PLCB3 Protein (Asp318-Lys468), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLCB3 Products
Required fields are marked with *
My Review for All PLCB3 Products
Required fields are marked with *