Recombinant Human PLCG2 protein, His-tagged
Cat.No. : | PLCG2-2820H |
Product Overview : | Recombinant Human PLCG2 protein(150-313 aa), fused to His tag, was expressed in E. coli. |
Availability | July 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 150-313 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | IYSVDQTRRNSISLRELKTILPLINFKVSSAKFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASAVYLRDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENSIWDEKYDAVDMQD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PLCG2 phospholipase C, gamma 2 (phosphatidylinositol-specific) [ Homo sapiens ] |
Official Symbol | PLCG2 |
Synonyms | PLCG2; phospholipase C, gamma 2 (phosphatidylinositol-specific); 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; PLC-IV; PLC-gamma-2; phospholipase C-IV; phosphoinositide phospholipase C-gamma-2; FCAS3; |
Gene ID | 5336 |
mRNA Refseq | NM_002661 |
Protein Refseq | NP_002652 |
MIM | 600220 |
UniProt ID | P16885 |
◆ Recombinant Proteins | ||
PLCG2-1704H | Recombinant Human PLCG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLCG2-1018H | Recombinant Human PLCG2 protein, His & T7-tagged | +Inquiry |
PLCG2-4166R | Recombinant Rat PLCG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLCG2-1750H | Recombinant Human PLCG2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PLCG2-6818M | Recombinant Mouse PLCG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLCG2-3127HCL | Recombinant Human PLCG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLCG2 Products
Required fields are marked with *
My Review for All PLCG2 Products
Required fields are marked with *