Recombinant Human PLCZ1 protein, His/sumo-tagged
Cat.No. : | PLCZ1-137H |
Product Overview : | Recombinant Human PLCZ1(1-415aa) fused with His/sumotag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-415aa |
Description : | The protein encoded by this gene is a member of the phosphoinositide-specific phospholipase C family. Members in this family, classified into six isotypes that are tissue- and organ-specific, hydrolyze phosphatidylinositol 4,5-bisphosphate just before the phosphate group to yield diacylglycerol and inositol 1,4,5-trisphosphate. This protein localizes to the acrosome in spermatozoa and elicits Ca(2+) oscillations and egg activation during fertilization that leads to early embryonic development. Alternative splicing results in multiple transcript variants. |
Form : | Tris-based buffer,50% glycerol |
AA Sequence : | MEMRWFLSKIQDDFRGGKINLEKTQRLLEKLDIRCSYIHVKQIFKTSDYPVVLSLENHCSTAQQEVMADNLQATF GESLLSDMLDDFPDTLPSPEALKFKILVKNKKIGTLKETHERKGSDKRGDNQDKETGVKKLPGVMLFKKKKTRKL KIALALSDLVIYTKAEKFKSFQHSRLYQQFNENNSIGETQARKLSKLRVHEFIFHTRKFITRIYPKATRADSSNF NPQEFWNIGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPHFLRESKSYFNPSNIKEGMPITLTIRLISGIQ LPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETFTFIIHVPELALIRFVVEGQGLIAGNEFL GQYTLPLLCMNKGYRRIPLFSRMGESLEPASLFVYVWYVR |
Purity : | >90% ( SDS-PAGE ) |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. |
Gene Name | PLCZ1 phospholipase C, zeta 1 [ Homo sapiens ] |
Official Symbol | PLCZ1 |
Synonyms | PLCZ1; phospholipase C, zeta 1; 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1; NYD SP27; PLCzeta; PLC-zeta-1; phospholipase C-zeta-1; PI-phospholipase C zeta 1; testis-development protein NYD-SP27; testis-development related NYD-SP27; phosphoinositide phospholipase C-zeta-1; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase zeta-1; NYD-SP27; MGC149685; |
Gene ID | 89869 |
mRNA Refseq | NM_033123 |
Protein Refseq | NP_149114 |
MIM | 608075 |
UniProt ID | Q86YW0 |
Chromosome Location | 12p13.31 |
Pathway | Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; D-myo-inositol (1,4,5)-trisphosphate biosynthesis, organism-specific biosystem; D-myo-inositol-5-phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, organism-specific biosystem; Inositol phosphate metabolism, conserved biosystem; Inositol phosphate metabolism, PI=> |
Function | calcium ion binding; hydrolase activity; phosphatidylinositol phospholipase C activity; signal transducer activity; |
◆ Recombinant Proteins | ||
PLCZ1-4168R | Recombinant Rat PLCZ1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLCZ1-137H | Recombinant Human PLCZ1 protein, His/sumo-tagged | +Inquiry |
PLCZ1-2596H | Recombinant Human PLCZ1 Protein, His-tagged | +Inquiry |
PLCZ1-4508R | Recombinant Rat PLCZ1 Protein | +Inquiry |
PLCZ1-6822M | Recombinant Mouse PLCZ1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLCZ1 Products
Required fields are marked with *
My Review for All PLCZ1 Products
Required fields are marked with *