Recombinant Human PLD3, GST-tagged

Cat.No. : PLD3-105H
Product Overview : Recombinant Human PLD3(1 a.a. - 490 a.a.) , fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the phospholipase D (PLD) family of enzymes that catalyze the hydrolysis of membrane phospholipids. The encoded protein is a single-pass type II membrane protein and contains two PLD phosphodiesterase domains. This protein influences processing of amyloid-beta precursor protein. Mutations in this gene are associated with Alzheimer disease risk. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Molecular Mass : 81.1 kDa
AA Sequence : MKPKLMYQELKVPAEEPANELPMNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPA PCYDPCEAVLVESIPEGLDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLRQ LQTLAPKGVNVRIAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLT QVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRFYDTRYNQETPMEICLNGTPALAYLASAPPPLC PSGRTPDLKALLNVVDNARSFIYVAVMNYLPTLEFSHPHRFWPAIDDGLRRATYERGVKVRLLISCWGHSEPSMR AFLLSLAALRDNHTHSDIQVKLFVVPADEAQARIPYARVNHNKYMVTERATYIGTSNWSGNYFTETAGTSLLVTQ NGRGGLRSQLEAIFLRDWDSPYSHDLDTSADSVGNACRLL
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PLD3 phospholipase D family, member 3 [ Homo sapiens (human) ]
Official Symbol PLD3
Synonyms PLD3; HUK4; HU-K4; phospholipase D family, member 3; hospholipase D3; PLD 3; hindIII K4L homolog; choline phosphatase 3; phosphatidylcholine-hydrolyzing phospholipase D3; NP_001026866.1; EC 3.1.4.4; NP_036400.2
Gene ID 23646
mRNA Refseq NM_001031696
Protein Refseq NP_001026866
MIM 615698
UniProt ID Q8IV08
Chromosome Location 19q13.2
Pathway Ether lipid metabolism; Glycerophospholipid biosynthesis; Phospholipid metabolism
Function NAPE-specific phospholipase D activity; phospholipase D activity; protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLD3 Products

Required fields are marked with *

My Review for All PLD3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon