Recombinant Human PLD3, GST-tagged
Cat.No. : | PLD3-105H |
Product Overview : | Recombinant Human PLD3(1 a.a. - 490 a.a.) , fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the phospholipase D (PLD) family of enzymes that catalyze the hydrolysis of membrane phospholipids. The encoded protein is a single-pass type II membrane protein and contains two PLD phosphodiesterase domains. This protein influences processing of amyloid-beta precursor protein. Mutations in this gene are associated with Alzheimer disease risk. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
Molecular Mass : | 81.1 kDa |
AA Sequence : | MKPKLMYQELKVPAEEPANELPMNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPA PCYDPCEAVLVESIPEGLDFPNASTGNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLRQ LQTLAPKGVNVRIAVSKPSGPQPQADLQALLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLT QVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRFYDTRYNQETPMEICLNGTPALAYLASAPPPLC PSGRTPDLKALLNVVDNARSFIYVAVMNYLPTLEFSHPHRFWPAIDDGLRRATYERGVKVRLLISCWGHSEPSMR AFLLSLAALRDNHTHSDIQVKLFVVPADEAQARIPYARVNHNKYMVTERATYIGTSNWSGNYFTETAGTSLLVTQ NGRGGLRSQLEAIFLRDWDSPYSHDLDTSADSVGNACRLL |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PLD3 phospholipase D family, member 3 [ Homo sapiens (human) ] |
Official Symbol | PLD3 |
Synonyms | PLD3; HUK4; HU-K4; phospholipase D family, member 3; hospholipase D3; PLD 3; hindIII K4L homolog; choline phosphatase 3; phosphatidylcholine-hydrolyzing phospholipase D3; NP_001026866.1; EC 3.1.4.4; NP_036400.2 |
Gene ID | 23646 |
mRNA Refseq | NM_001031696 |
Protein Refseq | NP_001026866 |
MIM | 615698 |
UniProt ID | Q8IV08 |
Chromosome Location | 19q13.2 |
Pathway | Ether lipid metabolism; Glycerophospholipid biosynthesis; Phospholipid metabolism |
Function | NAPE-specific phospholipase D activity; phospholipase D activity; protein binding |
◆ Recombinant Proteins | ||
PLD3-106H | Recombinant Human PLD3, MYC/DDK-tagged | +Inquiry |
Pld3-4922M | Recombinant Mouse Pld3 Protein, Myc/DDK-tagged | +Inquiry |
PLD3-1771H | Recombinant Human PLD3, GST-tagged | +Inquiry |
PLD3-2979HFL | Recombinant Full Length Human PLD3, Flag-tagged | +Inquiry |
PLD3-384HF | Recombinant Full Length Human PLD3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLD3-3122HCL | Recombinant Human PLD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLD3 Products
Required fields are marked with *
My Review for All PLD3 Products
Required fields are marked with *