Recombinant Mouse Pld3 Full Length Transmembrane protein, His-tagged
| Cat.No. : | Pld3-2388M |
| Product Overview : | Recombinant Mouse Pld3 protein(O35405)(1-488aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-488aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 58.2 kDa |
| AA Sequence : | MKPKLMYQELKVPVEEPAGELPLNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLEFPNATTSNPSTSQAWLGLLAGAHSSLDIASFYWTLTNNDTHTQEPSAQQGEEVLQQLQALAPRGVKVRIAVSKPNGPLADLQSLLQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLTQVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRSFDTRYNQETPMEICLNGTPALAYLASAPPPLCPSGRTPDLKALLNVVDSARSFIYIAVMNYLPTMEFSHPRRFWPAIDDGLRRAAYERGVKVRLLISCWGHSDPSMRSFLLSLAALHDNHTHSDIQVKLFVVPTDESQARIPYARVNHNKYMVTERASYIGTSNWSGSYFTETAGTSLLVTQNGHGGLRSQLEAVFLRDWESPYSHDLDTSANSVGNACRLL |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Pld3 phospholipase D family, member 3 [ Mus musculus ] |
| Official Symbol | Pld3 |
| Synonyms | PLD3; phospholipase D family, member 3; phospholipase D3; PLD 3; choline phosphatase 3; schwannoma-associated protein 9; phosphatidylcholine-hydrolyzing phospholipase D3; Sam-9; |
| Gene ID | 18807 |
| mRNA Refseq | NM_011116 |
| Protein Refseq | NP_035246 |
| ◆ Recombinant Proteins | ||
| PLD3-384HF | Recombinant Full Length Human PLD3 Protein, GST-tagged | +Inquiry |
| PLD3-30088TH | Recombinant Human PLD3, His-tagged | +Inquiry |
| RFL12565MF | Recombinant Full Length Mouse Phospholipase D3(Pld3) Protein, His-Tagged | +Inquiry |
| Pld3-4922M | Recombinant Mouse Pld3 Protein, Myc/DDK-tagged | +Inquiry |
| PLD3-12935M | Recombinant Mouse PLD3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLD3-3122HCL | Recombinant Human PLD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pld3 Products
Required fields are marked with *
My Review for All Pld3 Products
Required fields are marked with *
