Recombinant Human PLD5 protein, His-tagged
Cat.No. : | PLD5-2770H |
Product Overview : | Recombinant Human PLD5 protein(272 - 495 aa), fused to His tag, was expressed in E. coli. |
Availability | July 05, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 272 - 495 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SLKFKSRVPQTWSKRLYGVYDNEKKLQLQLNETKSQAFVSNSPKLFCPKNRSFDIDAIYSVIDDAKQYVYIAVMDYLPISSTSTKRTYWPDLDAKIREALVLRSVRVRLLLSFWKETDPLTFNFISSLKAICTEIANCSLKVKFFDLERENACATKEQKNHTFPRLNRNKYMVTDGAAYIGNFDWVGNDFTQNAGTGLVINQADVRNNRSIIKQLKDVFERDWY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PLD5 phospholipase D family, member 5 [ Homo sapiens ] |
Official Symbol | PLD5 |
Synonyms | PLD5; phospholipase D family, member 5; inactive phospholipase D5; FLJ40773; inactive PLD 5; inactive choline phosphatase 5; inactive phosphatidylcholine-hydrolyzing phospholipase D5; PLDC; MGC120565; MGC120566; MGC120567; |
Gene ID | 200150 |
mRNA Refseq | NM_001195811 |
Protein Refseq | NP_001182740 |
UniProt ID | Q8N7P1 |
◆ Recombinant Proteins | ||
PLD5-4529C | Recombinant Chicken PLD5 | +Inquiry |
RFL32444HF | Recombinant Full Length Human Inactive Phospholipase D5(Pld5) Protein, His-Tagged | +Inquiry |
PLD5-1077H | Recombinant Human PLD5 Protein (92-536 aa), His-SUMO-tagged | +Inquiry |
PLD5-2770H | Recombinant Human PLD5 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLD5 Products
Required fields are marked with *
My Review for All PLD5 Products
Required fields are marked with *