Recombinant Human PLEKHB2 protein, GST-tagged
| Cat.No. : | PLEKHB2-1781H |
| Product Overview : | Recombinant Human PLEKHB2 protein(1-201 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | November 09, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-201 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAPEQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | PLEKHB2 pleckstrin homology domain containing, family B (evectins) member 2 [ Homo sapiens ] |
| Official Symbol | PLEKHB2 |
| Synonyms | PLEKHB2; pleckstrin homology domain containing, family B (evectins) member 2; pleckstrin homology domain-containing family B member 2; EVT2; FLJ20783; evectin-2; PH domain-containing family B member 2; FLJ23679; FLJ30436; |
| Gene ID | 55041 |
| mRNA Refseq | NM_001100623 |
| Protein Refseq | NP_001094093 |
| UniProt ID | Q96CS7 |
| ◆ Recombinant Proteins | ||
| PLEKHB2-6832M | Recombinant Mouse PLEKHB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PLEKHB2-11235Z | Recombinant Zebrafish PLEKHB2 | +Inquiry |
| PLEKHB2-12950M | Recombinant Mouse PLEKHB2 Protein | +Inquiry |
| PLEKHB2-1781H | Recombinant Human PLEKHB2 protein, GST-tagged | +Inquiry |
| PLEKHB2-2958C | Recombinant Chicken PLEKHB2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLEKHB2-3114HCL | Recombinant Human PLEKHB2 293 Cell Lysate | +Inquiry |
| PLEKHB2-3113HCL | Recombinant Human PLEKHB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLEKHB2 Products
Required fields are marked with *
My Review for All PLEKHB2 Products
Required fields are marked with *
