Recombinant Human PLEKHH3 Protein, GST-tagged
Cat.No. : | PLEKHH3-4265H |
Product Overview : | Human FLJ21019 partial ORF ( NP_079203, 665 a.a. - 750 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | PLEKHH3 (Pleckstrin Homology, MyTH4 And FERM Domain Containing H3) is a Protein Coding gene. An important paralog of this gene is MYO1C. |
Molecular Mass : | 35.2 kDa |
AA Sequence : | DVLELSTEPGRGAPQKLCLGLGAKAMSLSRPGETEPIHSVSYGHVAACQLMGPHTLALRVGESQLLLQSPQVEEIMQLVNAYLANP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PLEKHH3 pleckstrin homology domain containing, family H (with MyTH4 domain) member 3 [ Homo sapiens ] |
Official Symbol | PLEKHH3 |
Synonyms | PLEKHH3; pleckstrin homology domain containing, family H (with MyTH4 domain) member 3; pleckstrin homology domain-containing family H member 3; FLJ21019; PH domain-containing family H member 3; |
Gene ID | 79990 |
mRNA Refseq | NM_024927 |
Protein Refseq | NP_079203 |
UniProt ID | Q7Z736 |
◆ Recombinant Proteins | ||
PLEKHH3-12962M | Recombinant Mouse PLEKHH3 Protein | +Inquiry |
PLEKHH3-4519R | Recombinant Rat PLEKHH3 Protein | +Inquiry |
PLEKHH3-4179R | Recombinant Rat PLEKHH3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLEKHH3-4265H | Recombinant Human PLEKHH3 Protein, GST-tagged | +Inquiry |
PLEKHH3-6839M | Recombinant Mouse PLEKHH3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLEKHH3 Products
Required fields are marked with *
My Review for All PLEKHH3 Products
Required fields are marked with *