Recombinant Human PLEKHH3 Protein, GST-tagged

• Cat.No.: PLEKHH3-4265H
• Product Overview: Human FLJ21019 partial ORF ( NP_079203, 665 a.a. - 750 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: PLEKHH3 (Pleckstrin Homology, MyTH4 And FERM Domain Containing H3) is a Protein Coding gene. An important paralog of this gene is MYO1C.
• Molecular Mass: 35.2 kDa
• AA Sequence: DVLELSTEPGRGAPQKLCLGLGAKAMSLSRPGETEPIHSVSYGHVAACQLMGPHTLALRVGESQLLLQSPQVEEIMQLVNAYLANP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PLEKHH3 pleckstrin homology domain containing, family H (with MyTH4 domain) member 3 [ Homo sapiens ]
• Official Symbol: PLEKHH3
• Synonyms: PLEKHH3; pleckstrin homology domain containing, family H (with MyTH4 domain) member 3; pleckstrin homology domain-containing family H member 3; FLJ21019; PH domain-containing family H member 3
• Gene ID: 79990
• mRNA Refseq: NM_024927
• Protein Refseq: NP_079203
• UniProt ID: Q7Z736