Recombinant Human PLEKHH3 Protein, GST-tagged

Cat.No. : PLEKHH3-4265H
Product Overview : Human FLJ21019 partial ORF ( NP_079203, 665 a.a. - 750 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : PLEKHH3 (Pleckstrin Homology, MyTH4 And FERM Domain Containing H3) is a Protein Coding gene. An important paralog of this gene is MYO1C.
Molecular Mass : 35.2 kDa
AA Sequence : DVLELSTEPGRGAPQKLCLGLGAKAMSLSRPGETEPIHSVSYGHVAACQLMGPHTLALRVGESQLLLQSPQVEEIMQLVNAYLANP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PLEKHH3 pleckstrin homology domain containing, family H (with MyTH4 domain) member 3 [ Homo sapiens ]
Official Symbol PLEKHH3
Synonyms PLEKHH3; pleckstrin homology domain containing, family H (with MyTH4 domain) member 3; pleckstrin homology domain-containing family H member 3; FLJ21019; PH domain-containing family H member 3;
Gene ID 79990
mRNA Refseq NM_024927
Protein Refseq NP_079203
UniProt ID Q7Z736

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLEKHH3 Products

Required fields are marked with *

My Review for All PLEKHH3 Products

Required fields are marked with *

0
cart-icon