Recombinant Human plexin A2 Protein, GST-tagged

Cat.No. : PLXNA2-23H
Product Overview : Recombinant Human cDNA FLJ11751 fis, clone HEMBA1005576, moderately similar to Mus musculus plexin 2 (H11Y , S17F) with N-GST tag was expressed in yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : GST
Protein Length : 1743-1894aa
Description : This gene encodes a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C.
Tag : N-GST
Form : Lyophilized powder
Molecular Mass : 43 kDa
AA Sequence : MHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLDKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMSIES
Purity : ≥85 %, by SDS-PAGE quantitative densitometry by Coomassie Blue Staining.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : Short term: 2 to 8 centigrade, one week after reconstitution
Long term: -20 to -80 centigrade, twelve months from the date of receipt
Storage Buffer : Lyophilized from PBS, 6 % Trehalose, pH 7.4. The volume before lyophilization is 500μl/vial.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50 % of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50 %. Customers could use it as reference.
Gene Name PLXNA2 plexin A2 [Homo sapiens (human)]
Official Symbol PLXNA2
Synonyms PLXNA2; plexin A2; PLXN2; plexin-A2; FLJ11751; FLJ30634; KIAA0463; OCT; plexin 2; semaphorin receptor OCT; transmembrane protein OCT
Gene ID 5362
mRNA Refseq NM_025179
Protein Refseq NP_079455
MIM 601054
UniProt ID Q9HAE7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLXNA2 Products

Required fields are marked with *

My Review for All PLXNA2 Products

Required fields are marked with *

0
cart-icon
0
compare icon