Recombinant Human plexin A2 Protein, GST-tagged
Cat.No. : | PLXNA2-23H |
Product Overview : | Recombinant Human cDNA FLJ11751 fis, clone HEMBA1005576, moderately similar to Mus musculus plexin 2 (H11Y , S17F) with N-GST tag was expressed in yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | GST |
Protein Length : | 1743-1894aa |
Description : | This gene encodes a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C. |
Tag : | N-GST |
Form : | Lyophilized powder |
Molecular Mass : | 43 kDa |
AA Sequence : | MHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLDKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMSIES |
Purity : | ≥85 %, by SDS-PAGE quantitative densitometry by Coomassie Blue Staining. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | Short term: 2 to 8 centigrade, one week after reconstitution Long term: -20 to -80 centigrade, twelve months from the date of receipt |
Storage Buffer : | Lyophilized from PBS, 6 % Trehalose, pH 7.4. The volume before lyophilization is 500μl/vial. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50 % of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50 %. Customers could use it as reference. |
Gene Name | PLXNA2 plexin A2 [Homo sapiens (human)] |
Official Symbol | PLXNA2 |
Synonyms | PLXNA2; plexin A2; PLXN2; plexin-A2; FLJ11751; FLJ30634; KIAA0463; OCT; plexin 2; semaphorin receptor OCT; transmembrane protein OCT |
Gene ID | 5362 |
mRNA Refseq | NM_025179 |
Protein Refseq | NP_079455 |
MIM | 601054 |
UniProt ID | Q9HAE7 |
◆ Recombinant Proteins | ||
PLXNA2-312H | Recombinant Human Plexin A2 | +Inquiry |
Plxna2-5099M | Recombinant Mouse Plxna2 protein | +Inquiry |
PLXNA2-23H | Recombinant Human plexin A2 Protein, GST-tagged | +Inquiry |
PLXNA2-21H | Recombinant Human PLXNA2 protein(Thr861- Val1220), SUMO &His-tagged | +Inquiry |
PLXNA2-30876TH | Recombinant Human PLXNA2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLXNA2 Products
Required fields are marked with *
My Review for All PLXNA2 Products
Required fields are marked with *