Recombinant Human PLIN1 Protein, His tagged

• Cat.No.: PLIN1-001H
• Product Overview: Recombinant Human PLIN1 Protein with His tagged

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 8-145 aa
• Description: The protein encoded by this gene coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The encoded protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis. Alternatively spliced transcript variants varying in the 5' UTR, but encoding the same protein, have been found for this gene.
• Molecular Mass: 16 kDa
• AASequence: MTLLDGDLPEQENVLQRVLQLPVVSGTCECFQKTYTSTKEAHPLVASVCNAYEKGVQSASSLAAWSMEPVVRRLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNSISVPIASTSDKVLGAHHHHHHHH
• Endotoxin: <1EU/μg by LAL
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 5% Trehalose, 10% Glycerol
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: PLIN1 perilipin 1 [ Homo sapiens (human) ]
• Official Symbol: PLIN1
• Synonyms: PLIN1; perilipin 1; perilipin , PLIN; perilipin-1; lipid droplet-associated protein; PERI; PLIN; FPLD4
• Gene ID: 5346
• mRNA Refseq: NM_001145311
• Protein Refseq: NP_001138783
• MIM: 170290
• UniProt ID: O60240