Recombinant Human PLIN1 Protein, His tagged
| Cat.No. : | PLIN1-001H |
| Product Overview : | Recombinant Human PLIN1 Protein with His tagged |
| Availability | December 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 8-145 aa |
| Description : | The protein encoded by this gene coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The encoded protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis. Alternatively spliced transcript variants varying in the 5' UTR, but encoding the same protein, have been found for this gene. |
| Molecular Mass : | 16 kDa |
| AASequence : | MTLLDGDLPEQENVLQRVLQLPVVSGTCECFQKTYTSTKEAHPLVASVCNAYEKGVQSASSLAAWSMEPVVRRLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNSISVPIASTSDKVLGAHHHHHHHH |
| Endotoxin : | <1EU/μg by LAL |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4, 5% Trehalose, 10% Glycerol |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | PLIN1 perilipin 1 [ Homo sapiens (human) ] |
| Official Symbol | PLIN1 |
| Synonyms | PLIN1; perilipin 1; perilipin , PLIN; perilipin-1; lipid droplet-associated protein; PERI; PLIN; FPLD4 |
| Gene ID | 5346 |
| mRNA Refseq | NM_001145311 |
| Protein Refseq | NP_001138783 |
| MIM | 170290 |
| UniProt ID | O60240 |
| ◆ Recombinant Proteins | ||
| PLIN1-531H | Recombinant Human PLIN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Plin1-8044M | Recombinant Mouse Plin1 protein, His & GST-tagged | +Inquiry |
| PLIN1-001H | Recombinant Human PLIN1 Protein, His tagged | +Inquiry |
| Plin1-243M | Recombinant Mouse Plin1 Protein, MYC/DDK-tagged | +Inquiry |
| PLIN1-4184R | Recombinant Rat PLIN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLIN1 Products
Required fields are marked with *
My Review for All PLIN1 Products
Required fields are marked with *
