Recombinant Human PLIN1 Protein, His tagged

Cat.No. : PLIN1-001H
Product Overview : Recombinant Human PLIN1 Protein with His tagged
Availability December 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 8-145 aa
Description : The protein encoded by this gene coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The encoded protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis. Alternatively spliced transcript variants varying in the 5' UTR, but encoding the same protein, have been found for this gene.
Molecular Mass : 16 kDa
AASequence : MTLLDGDLPEQENVLQRVLQLPVVSGTCECFQKTYTSTKEAHPLVASVCNAYEKGVQSASSLAAWSMEPVVRRLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNSISVPIASTSDKVLGAHHHHHHHH
Endotoxin : <1EU/μg by LAL
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 5% Trehalose, 10% Glycerol
Concentration : 1 mg/mL by BCA
Gene Name PLIN1 perilipin 1 [ Homo sapiens (human) ]
Official Symbol PLIN1
Synonyms PLIN1; perilipin 1; perilipin , PLIN; perilipin-1; lipid droplet-associated protein; PERI; PLIN; FPLD4
Gene ID 5346
mRNA Refseq NM_001145311
Protein Refseq NP_001138783
MIM 170290
UniProt ID O60240

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLIN1 Products

Required fields are marked with *

My Review for All PLIN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon