Recombinant Human PLIN1 Protein, His tagged
Cat.No. : | PLIN1-001H |
Product Overview : | Recombinant Human PLIN1 Protein with His tagged |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 8-145 aa |
Description : | The protein encoded by this gene coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The encoded protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis. Alternatively spliced transcript variants varying in the 5' UTR, but encoding the same protein, have been found for this gene. |
Molecular Mass : | 16 kDa |
AASequence : | MTLLDGDLPEQENVLQRVLQLPVVSGTCECFQKTYTSTKEAHPLVASVCNAYEKGVQSASSLAAWSMEPVVRRLSTQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNSISVPIASTSDKVLGAHHHHHHHH |
Endotoxin : | <1EU/μg by LAL |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 5% Trehalose, 10% Glycerol |
Concentration : | 1 mg/mL by BCA |
Gene Name | PLIN1 perilipin 1 [ Homo sapiens (human) ] |
Official Symbol | PLIN1 |
Synonyms | PLIN1; perilipin 1; perilipin , PLIN; perilipin-1; lipid droplet-associated protein; PERI; PLIN; FPLD4 |
Gene ID | 5346 |
mRNA Refseq | NM_001145311 |
Protein Refseq | NP_001138783 |
MIM | 170290 |
UniProt ID | O60240 |
◆ Recombinant Proteins | ||
PLIN1-2302H | Recombinant Human PLIN1 Protein (411-496 aa), His-tagged | +Inquiry |
PLIN1-130HFL | Recombinant Full Length Human PLIN1 Protein, C-Flag-tagged | +Inquiry |
PLIN1-531H | Recombinant Human PLIN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PLIN1-12971M | Recombinant Mouse PLIN1 Protein | +Inquiry |
Plin1-8044M | Recombinant Mouse Plin1 protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
PLIN1-001H | Recombinant Human PLIN1 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLIN1 Products
Required fields are marked with *
My Review for All PLIN1 Products
Required fields are marked with *