Recombinant Human PLOD1 therapeutic protein(Lutropin alfa)
Cat.No. : | LH-P015H |
Product Overview : | The therapeutic protein is a recombinant human luteinizing hormone produced in yeast with 2 subunits, alpha = 92 residues, beta = 121 residues. It is a heterodimeric glycoprotein. Each monomeric unit is a glycoprotein molecule. In females, an acute rise of LH ("LH surge") triggers ovulation and the development of the corpus luteum. In males, it stimulates Leydig cell production of testosterone. It was the first and only recombinant human form of luteinizing hormone (LH) developed for use in the stimulation of follicular development. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | Non |
Description : | This gene is a member of the LHB family and encodes the beta subunit of luteinizing hormone (LH). LHB is heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. LHB is expressed in the pituitary gland and promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids. The genes for the beta chains of chorionic gonadotropin and for luteinizing hormone are contiguous on chromosome 19q13.3. Mutations in this gene are associated with hypogonadism which is characterized by infertility and pseudohermaphroditism. The expression product is the active ingredient of Luveris. |
Molecular Mass : | 30kDa |
AA Sequence : | >Alpha ChainAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS>Beta Chain (LH)SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Alias : | LH; LH1; LLH; EDS6; PLOD; Lutropin alfa; Lutropin alpha; Lutropina alfa |
Gene Name | PLOD1 procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 [ Homo sapiens ] |
Official Symbol | PLOD1 |
Synonyms | LH; LH1; LLH; EDS6; PLOD |
Gene ID | 5351 |
mRNA Refseq | NM_000302 |
Protein Refseq | NP_000293 |
MIM | 153454 |
UniProt ID | Q02809 |
Chromosome Location | 1p36.22 |
Pathway | Extracellular matrix organization, organism-specific biosystem; Collagen formation, organism-specific biosystem; Collagen biosynthesis and modifying enzymes, organism-specific biosystem |
◆ Recombinant Proteins | ||
PLOD1-152H | Recombinant Human PLOD1 protein, MYC/DDK-tagged | +Inquiry |
PLOD1-1180H | Recombinant Human PLOD1 protein, His-tagged | +Inquiry |
PLOD1-843HFL | Recombinant Full Length Human PLOD1 Protein, C-Flag-tagged | +Inquiry |
PLOD1-1248C | Recombinant Chicken PLOD1 | +Inquiry |
PLOD1-1709H | Recombinant Human PLOD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLOD1 Products
Required fields are marked with *
My Review for All PLOD1 Products
Required fields are marked with *
0
Inquiry Basket